Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16990 149 / 9e-42 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT5G46450 144 / 1e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G44480 141 / 1e-38 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16890 140 / 2e-38 BAL, SNC1 SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1, BALL, disease resistance protein (TIR-NBS-LRR class), putative (.1) AT2G16870 140 / 2e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72860 140 / 3e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16860 139 / 5e-38 RPP5, RPP4 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63730 139 / 6e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G44630 139 / 7e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT3G44670 139 / 7e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G030413 [exp] 199 / 2e-65 AT2G20142 132 / 5e-38 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G069866 [exp] 199 / 5e-65 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.005G030318 [exp] 212 / 1e-63 AT1G69550 673 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.005G030700 [exp] 211 / 4e-63 AT1G69550 602 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.019G069600 [exp] 203 / 2e-60 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.005G031101 [exp] 199 / 6e-59 AT5G17680 557 / 8e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069500 [exp] 199 / 7e-59 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070700 [exp] 197 / 2e-58 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.004G088500 [exp] 197 / 2e-58 AT1G69550 647 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013729 [exp] 166 / 4e-48 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011104 [exp] 166 / 2e-47 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10029722 [exp] 164 / 8e-47 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10042752 [exp] 149 / 6e-46 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10006929 [exp] 148 / 2e-44 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10014671 [exp] 148 / 3e-44 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10041060 [exp] 154 / 2e-43 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014582 [exp] 144 / 3e-42 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10006928 [exp] 144 / 4e-40 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10032101 [exp] 141 / 1e-39 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.005G062700.3 pacid=42804051 polypeptide=Potri.005G062700.3.p locus=Potri.005G062700 ID=Potri.005G062700.3.v4.1 annot-version=v4.1 ATGGCGTCAAGCTCTTCCGCCGTTACTCCTCTATGGAAGTATGATGTGTTCCTTAGTTTTAGAGGTGCTGACGTCCGCCATAACTTCCTTAGACATCTTT ATGATGCTCTAGATCAAAATGAAATCGAAACATTTATCGACTACAAACTTGGTGCTGGAGAAGAGATCTCACGGATCCTCTTGGAAAAAATCGAACAATC AAATGTTTCAATCGTCATTTTCTCCAAAAACTATGCAGATTCTCCTTGGTGTTTGGAAGAACTGGAGAAGATCCTCGAATGCAGGCAAACGTTACAGCAA ATTGTTATACCAGTATTTTACCATGTTGATCCAACCCATGTCCGAGAGCTGAGTAACAGTTATGGAAATGCACTTTCCGAGCATCAGAAAAAAATCAGTT CAGACAAGGTGGACAATTGGAAACGTGTTTTGATCGAAATAGCTGATCTAGAAGGCTGGCATTTTAATGACACTAAGAAAGAGTCTGAACTAGTCCAGGA AATTGTTGATTACATTAGGAAGGAGCTAAAACCTTTATCCTCAAGCAATTTTGGTAACTTGGTTGAAATTGGTTCATGTATTGGAAAGGTTGATGATAAT GAATATTTCATGTAA
AA sequence Show only first row Show all	>Potri.005G062700.3 pacid=42804051 polypeptide=Potri.005G062700.3.p locus=Potri.005G062700 ID=Potri.005G062700.3.v4.1 annot-version=v4.1 MASSSSAVTPLWKYDVFLSFRGADVRHNFLRHLYDALDQNEIETFIDYKLGAGEEISRILLEKIEQSNVSIVIFSKNYADSPWCLEELEKILECRQTLQQ IVIPVFYHVDPTHVRELSNSYGNALSEHQKKISSDKVDNWKRVLIEIADLEGWHFNDTKKESELVQEIVDYIRKELKPLSSSNFGNLVEIGSCIGKVDDN EYFM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G16990		RLM3	RESISTANCE TO LEPTOSPHAERIA MA...		Potri.005G062700 [exp]	0	1
					Potri.002G167500 [exp]	1.41	0.9623
AT1G78510		SPS1	solanesyl diphosphate synthase...		Potri.001G380500 [exp]	6.92	0.9424
AT3G52740			unknown protein		Potri.009G163900 [exp]	6.92	0.9393
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Potri.002G056800 [exp]	10.19	0.9379
AT1G32900		GBSS1	granule bound starch synthase ...		Potri.001G449500 [exp]	10.67	0.8909	Pt-GBSSI.3
AT5G65620			Zincin-like metalloproteases f...		Potri.009G151300 [exp]	12.24	0.9252
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.019G011400 [exp]	13.67	0.9192
AT5G62680			Major facilitator superfamily ...		Potri.012G071500 [exp]	14.38	0.9222
					Potri.005G182750 [exp]	14.66	0.9295
AT3G56010			unknown protein		Potri.008G070700 [exp]	16.94	0.9250

Compare expression of checked genes

Potri.005G062700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.