Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64530 199 / 3e-65 NAC ANAC104, XND1 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) AT1G61110 120 / 5e-33 NAC ANAC025 NAC domain containing protein 25 (.1) AT1G69490 119 / 6e-33 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT1G01720 117 / 3e-32 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 115 / 9e-32 NAC ANAC032 NAC domain containing protein 32 (.1) AT3G15510 116 / 5e-31 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT3G15500 114 / 1e-30 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT1G52890 114 / 1e-30 NAC ANAC019 NAC domain containing protein 19 (.1) AT5G63790 112 / 4e-30 NAC ANAC102 NAC domain containing protein 102 (.1) AT5G08790 110 / 2e-29 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G105000 [exp] 310 / 5e-109 AT5G64530 183 / 3e-59 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.003G022800 [exp] 199 / 4e-65 AT5G64530 231 / 5e-78 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.001G206900 [exp] 197 / 2e-64 AT5G64530 221 / 2e-74 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.004G038000 [exp] 128 / 7e-36 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.011G046700 [exp] 125 / 2e-34 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.002G081000 [exp] 123 / 2e-34 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.001G404400 [exp] 124 / 4e-34 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.005G180200 [exp] 121 / 8e-34 AT1G01720 392 / 9e-139 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.008G089000 [exp] 120 / 1e-33 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000206 [exp] 196 / 4e-64 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10035648 [exp] 196 / 4e-64 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10035647 [exp] 196 / 4e-64 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10010747 [exp] 194 / 3e-63 AT5G64530 259 / 4e-89 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10030446 [exp] 131 / 1e-37 AT1G69490 302 / 2e-103 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10011215 [exp] 132 / 3e-37 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10018469 [exp] 132 / 3e-37 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10026617 [exp] 130 / 3e-37 AT1G69490 298 / 1e-101 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10032657 [exp] 132 / 6e-37 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10043095 [exp] 131 / 9e-37 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.005G064100.1 pacid=42803735 polypeptide=Potri.005G064100.1.p locus=Potri.005G064100 ID=Potri.005G064100.1.v4.1 annot-version=v4.1 ATGGGCGATCATGGCTGCAGCGGCAACCTTCCTCCTGGATTTATTTTCAGCCCATCTGATGAAGAGCTCATCCTTCACTTTCTCGATCGCAAGGCCTCTC TCTTACCTTGCCACCCTGACATCATTCCCGATCTTGGTCTTTATCCTCAGGATCCTTGGCAGCTTGAAGGCAGGGCTCTGTGGAGTGAAAACCAGTGGTA CTACTTTAGTCGAGTGATGGAGAACCAAGCAACAGGAAATGGGTTTTGGAAGCCATTAGATATTGAAGAACCTATATTTAGTTCGAGTACTGGTAAGAAG GTTGGATTAAAGAAATACCTTGTGTACTGCATTGGTCCCGAAGGTGTAGAAACAAATTGGATGATGCAGGAATATCATCTTTGCAGTAGTAAGTCGAGCG GCAAATCCTACAAGAGAAAGCAAAAATTAGATTGCAGTAAATGGATCCTATGTCGAGTTTATCAGAGGGAAGGAAGCTGTTCCAAGAGTTCAAACCACAG TGATGATGATGATGGAACCGAGCTTTCATGCCTAGATGAGATGTTCTTATCAATGGATGATCTTGATGATATAAGTTTTCCAAATTAG
AA sequence Show only first row Show all	>Potri.005G064100.1 pacid=42803735 polypeptide=Potri.005G064100.1.p locus=Potri.005G064100 ID=Potri.005G064100.1.v4.1 annot-version=v4.1 MGDHGCSGNLPPGFIFSPSDEELILHFLDRKASLLPCHPDIIPDLGLYPQDPWQLEGRALWSENQWYYFSRVMENQATGNGFWKPLDIEEPIFSSSTGKK VGLKKYLVYCIGPEGVETNWMMQEYHLCSSKSSGKSYKRKQKLDCSKWILCRVYQREGSCSKSSNHSDDDDGTELSCLDEMFLSMDDLDDISFPN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64530	NAC	ANAC104, XND1	Arabidopsis NAC domain contain...		Potri.005G064100 [exp]	0	1
AT1G79390			unknown protein		Potri.010G174700 [exp]	3.00	0.7421
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Potri.001G416500 [exp]	16.61	0.6831
AT3G63120		CYCP1;1	cyclin p1;1 (.1)		Potri.005G209800 [exp]	20.49	0.6876
AT4G38960	CO		B-box type zinc finger family ...		Potri.004G162600 [exp]	25.49	0.6624
AT5G43150			unknown protein		Potri.003G187500 [exp]	30.59	0.6651
AT4G19150			Ankyrin repeat family protein ...		Potri.001G130500 [exp]	31.60	0.6134
AT3G47510			unknown protein		Potri.013G066600 [exp]	40.79	0.6363
AT5G22920			CHY-type/CTCHY-type/RING-type ...		Potri.006G121801 [exp]	40.84	0.6592
AT5G19473			RPM1-interacting protein 4 (RI...		Potri.009G067600 [exp]	40.91	0.6334
AT2G25910			3'-5' exonuclease domain-conta...		Potri.018G058900 [exp]	43.35	0.6288

Compare expression of checked genes

Potri.005G064100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.