Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31305 66 / 4e-15 INH3 inhibitor-3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G101900 [exp] 82 / 1e-21 AT2G31305 68 / 5e-16 inhibitor-3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018105 [exp] 69 / 3e-16 AT2G31305 105 / 1e-30 inhibitor-3 (.1) Lus10022410 [exp] 69 / 5e-15 AT2G31305 104 / 1e-27 inhibitor-3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07491 [poplar] [flax] PPI_Ypi1 Protein phosphatase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.005G067400.3 pacid=42804601 polypeptide=Potri.005G067400.3.p locus=Potri.005G067400 ID=Potri.005G067400.3.v4.1 annot-version=v4.1 ATGAGCACCACCGCGACAACCACCACCGTAATGAGAACACCACCTTCTTCCTCCACAACCACCACCTTCCTGGAAAATCTCACCCGGCAACAGCAACAGA CCCTAACTTTGCGCTTAAATCGGCCGAAAAAGAAGGTTTCGTGGAAAGAAGGCACTGTCGATAACGAGTATATGCAGAAGAAAAGTTCTAAAATATGTTG TATTTTCCACAAGGAGAAGCCCTTCGATGAGGATGATAGCGATGATGATTGCAATCATGATCATAAATCGGACGGTGCTTGTTCTTCTTCTCAAAACAAC GGGGGAGAGAGTTAA
AA sequence Show only first row Show all	>Potri.005G067400.3 pacid=42804601 polypeptide=Potri.005G067400.3.p locus=Potri.005G067400 ID=Potri.005G067400.3.v4.1 annot-version=v4.1 MSTTATTTTVMRTPPSSSTTTTFLENLTRQQQQTLTLRLNRPKKKVSWKEGTVDNEYMQKKSSKICCIFHKEKPFDEDDSDDDCNHDHKSDGACSSSQNN GGES

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G31305		INH3	inhibitor-3 (.1)		Potri.005G067400 [exp]	0	1
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Potri.016G014100 [exp]	2.44	0.9465
AT3G07790			DGCR14-related (.1)		Potri.014G164200 [exp]	3.74	0.9138
AT1G36370		SHM7	serine hydroxymethyltransferas...		Potri.002G090200 [exp]	7.14	0.9018	SHMT4
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Potri.016G014300 [exp]	11.83	0.9054
					Potri.006G044300 [exp]	12.48	0.8905
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Potri.001G190100 [exp]	13.26	0.9051
AT2G46370		FIN219, JAR1	JASMONATE RESISTANT 1, FAR-RED...		Potri.002G168200 [exp]	16.49	0.8914
AT3G15780			unknown protein		Potri.001G192500 [exp]	16.73	0.9165
AT2G45330		TRPT, EMB1067	2' tRNA phosphotransferase, em...		Potri.002G117000 [exp]	16.79	0.8881
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Potri.008G029700 [exp]	16.97	0.9135

Compare expression of checked genes

Potri.005G067400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.