Potri.005G067600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62950 144 / 1e-44 RNA polymerase II, Rpb4, core protein (.1.2.3)
AT3G28956 132 / 5e-40 RNA polymerase II, Rpb4, core protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005329 102 / 2e-28 AT5G62950 117 / 1e-34 RNA polymerase II, Rpb4, core protein (.1.2.3)
Lus10039583 86 / 7e-22 AT5G62950 119 / 1e-35 RNA polymerase II, Rpb4, core protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0426 HRDC-like PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Representative CDS sequence
>Potri.005G067600.1 pacid=42805658 polypeptide=Potri.005G067600.1.p locus=Potri.005G067600 ID=Potri.005G067600.1.v4.1 annot-version=v4.1
ATGAAGATAAAAAACCCAAATGCAGGTGCCCTAACCAATTTTGAAGTGCTTGATTTTCTAAGATCAAGAGGTGCCTCAAGGGATGTCTCGCGGGTTCTTG
CTCCCGTAGCAGCATCAGAATACAAGGTTTATGATTATTTGGTTGAAACTCCTGCGTGCAATCTAACAAGAGAGAAAATCAATGAATTCTTAGAGAGATG
TAAGAAGTACGACCTTGCCAAAGCTGAGCTTCTTAATATTATCAATATTAGGCCTTCTCAAACTGTCGAAATTTACACGATCATAGAGGAAATGGATTCA
CGTTTTGAAATGCCAATCATTGAAGAACTTGTTGAATTGGTTGAAGAGGTTCTGCCACCTCCTCCAGGCCAACCAAAAGCCGAAGGAGGGACTGATGAGA
ATGAAGAAGAAACTGGAGAAGGGGAAGAGGACAATGATGAAAACGAAGCTGCAGATGAGGAAGAACCGGAAACAAGTTGA
AA sequence
>Potri.005G067600.1 pacid=42805658 polypeptide=Potri.005G067600.1.p locus=Potri.005G067600 ID=Potri.005G067600.1.v4.1 annot-version=v4.1
MKIKNPNAGALTNFEVLDFLRSRGASRDVSRVLAPVAASEYKVYDYLVETPACNLTREKINEFLERCKKYDLAKAELLNIINIRPSQTVEIYTIIEEMDS
RFEMPIIEELVELVEEVLPPPPGQPKAEGGTDENEEETGEGEEDNDENEAADEEEPETS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G62950 RNA polymerase II, Rpb4, core ... Potri.005G067600 0 1
AT4G14660 NRPE7 RNA polymerase Rpb7-like, N-te... Potri.010G077300 3.74 0.8424
Potri.015G008200 7.54 0.8143
Potri.009G105900 8.60 0.8249
AT5G22280 unknown protein Potri.016G073500 8.83 0.8344
AT5G61190 C2H2ZnF putative endonuclease or glyco... Potri.017G091700 9.21 0.8410
AT3G23560 ALF5 ABERRANT LATERAL ROOT FORMATIO... Potri.011G117300 9.74 0.8614 Pt-HLS3.1
AT4G38090 Ribosomal protein S5 domain 2-... Potri.007G010400 10.24 0.8419
AT1G21065 unknown protein Potri.002G001500 13.30 0.8829
AT1G01940 Cyclophilin-like peptidyl-prol... Potri.014G071600 18.49 0.8242
AT4G39470 Tetratricopeptide repeat (TPR)... Potri.005G085700 19.59 0.8282

Potri.005G067600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.