Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08710 515 / 0 RUG1 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G63860 171 / 2e-48 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G19420 146 / 6e-38 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT5G12350 143 / 6e-37 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT3G47660 124 / 2e-30 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G42140 118 / 2e-28 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G27060 113 / 9e-28 Regulator of chromosome condensation (RCC1) family protein (.1) AT1G76950 115 / 2e-27 PRAF1 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G69710 113 / 1e-26 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G16040 110 / 1e-26 Regulator of chromosome condensation (RCC1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G100200 [exp] 175 / 6e-50 AT5G63860 738 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.001G026900 [exp] 136 / 2e-34 AT5G19420 1281 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.T124906 [exp] 135 / 2e-34 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.003G197600 [exp] 135 / 2e-34 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.001G276900 [exp] 133 / 2e-33 AT5G19420 1483 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.009G071800 [exp] 132 / 3e-33 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.008G167500 [exp] 124 / 3e-30 AT4G14368 1266 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.004G101800 [exp] 117 / 4e-29 AT5G16040 665 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.005G190000 [exp] 118 / 2e-28 AT5G42140 1407 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035957 [exp] 539 / 0 AT5G08710 504 / 1e-178 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10039618 [exp] 164 / 1e-45 AT5G63860 715 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10036030 [exp] 136 / 2e-34 AT5G19420 1644 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10029536 [exp] 130 / 2e-33 AT5G63860 642 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10009701 [exp] 131 / 9e-33 AT5G19420 1567 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10036737 [exp] 123 / 4e-30 AT1G69710 974 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10037192 [exp] 123 / 5e-30 AT1G69710 986 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10016335 [exp] 121 / 2e-29 AT5G19420 971 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10039525 [exp] 119 / 1e-28 AT5G19420 1245 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10002751 [exp] 119 / 1e-28 AT5G19420 949 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF00415 [poplar] [flax] RCC1 Regulator of chromosome condensation (RCC1) repeat CL0186 [poplar] [flax] Beta_propeller PF13540 [poplar] [flax] RCC1_2 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Potri.005G071000.1 pacid=42805344 polypeptide=Potri.005G071000.1.p locus=Potri.005G071000 ID=Potri.005G071000.1.v4.1 annot-version=v4.1 ATGAGAAAAAATAGTGTGTTAATAGGAGGAGGATTAGGTTATTGTTATAAACGATGGATGTCGTCGTCGTCAAGCAAAGGAAGAAAGAGATCCGCAGCAG TGTGGGGTAATGGTGACTACGGAAGATTAGGATACGGAAACTTAGATTCTATGTGGAGACCTAAGCTTATGAATTCCTCTTCCTTTCATAATTCTAATCT CAAATCCATTTCTTGTGGCGGTGCTCACACTCTCTTCTTAACAGAAACTGGGCGTGTTTATGCCACCGGTCTTAATGATTTTGGACAGCTCGGCGTATCA AACAACACTACTTATTGTATGGAGCCACTTGAAGTTTCTGGTCTCAAAAAGGAAATTGTGCAAATTTCAGCTGGTTATCATCACTCATGTGCTATTACAG TGGATGGAGAGCTCTATACGTGGGGAAAGAACTCAAATGGACAGCTGGGTCTTGGAAAAAAGGCTGAAAACGTAGTCCCTGTACCAACAAAAGTAGAATG TTTGAGCGGAATCAACATTAAAATGGTAGCTTTGGCTTCAGAGCACTCAATTGCAGTTACTGATGGAGGTCAGGCCTTGAGTTGGGGAGGAGGAGGATCT GGGCGACTTGGTCATGGCCATCAATCAAGTCTTTTGGGGTTTTTTAGAAGCAGCAGTGAATATACACCTAGACACATTAAGAAACTTGAAGGGGTTAAGG TTAAAAACATTGCTGCCGGCTTGCTTCATTCAGCCTGCATTGATGAGAACGGCTCTGTCTACATATTTGGTGAAAAAGCAGTAGATAAACTGGCTTTTGG AGATGCGAACAACGCAACGACGCCATCTATGATAGGCAAATTGCCTTATTCTCAAGAAGTAGCATGTGGTGGCTATCACACATGTGTTATAACTAGTGGT GGTGAACTATACACTTGGGGCTCAAATGAAAATGGTTGTCTTGGCAACGGTTCTATTGATGTCTTGCATATTCCGGAGCGAGTTGAAGGCCCTTTTTTGA GATCTCCTGTTGAAAAGGTATCTTGTGGTTGGAAGCATACAGCAGCGATTTCAGAAGGCAATGTGTTTACCTGGGGCTGGGGAGGTTCACATGGAACATT TTCTGAAGATGGACTTTCTTCTGGTGGACAATTGGGTCATGGGGATGATTTTGACTACGTAAATCCTACATTGGTTGCCTTCGAGAAGAAAATGAAAGCA TTGGAAGTGTCATGTGGGTTTAATCACACAGGTGCCATACTTGAAAGTGTTGATGCTTAA
AA sequence Show only first row Show all	>Potri.005G071000.1 pacid=42805344 polypeptide=Potri.005G071000.1.p locus=Potri.005G071000 ID=Potri.005G071000.1.v4.1 annot-version=v4.1 MRKNSVLIGGGLGYCYKRWMSSSSSKGRKRSAAVWGNGDYGRLGYGNLDSMWRPKLMNSSSFHNSNLKSISCGGAHTLFLTETGRVYATGLNDFGQLGVS NNTTYCMEPLEVSGLKKEIVQISAGYHHSCAITVDGELYTWGKNSNGQLGLGKKAENVVPVPTKVECLSGINIKMVALASEHSIAVTDGGQALSWGGGGS GRLGHGHQSSLLGFFRSSSEYTPRHIKKLEGVKVKNIAAGLLHSACIDENGSVYIFGEKAVDKLAFGDANNATTPSMIGKLPYSQEVACGGYHTCVITSG GELYTWGSNENGCLGNGSIDVLHIPERVEGPFLRSPVEKVSCGWKHTAAISEGNVFTWGWGGSHGTFSEDGLSSGGQLGHGDDFDYVNPTLVAFEKKMKA LEVSCGFNHTGAILESVDA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G08710		RUG1	RCC1/UVR8/GEF-like 1, Regulato...		Potri.005G071000 [exp]	0	1
AT1G56440		TPR5	tetratricopeptide repeat 5, Te...		Potri.005G014100 [exp]	6.40	0.8320
					Potri.003G089201 [exp]	6.78	0.8144
AT3G17890			unknown protein		Potri.008G145400 [exp]	9.16	0.7751
AT5G54130			Calcium-binding endonuclease/e...		Potri.014G108200 [exp]	14.28	0.6836
AT4G10490			2-oxoglutarate (2OG) and Fe(II...		Potri.011G150100 [exp]	18.54	0.7918
AT5G42820	C3HZnF	ATU2AF35B	Zinc finger C-x8-C-x5-C-x3-H t...		Potri.004G188900 [exp]	22.71	0.8079
AT4G02890		UBQ14	Ubiquitin family protein (.1.2...		Potri.017G135600 [exp]	29.25	0.8096	Pt-SUBI.8
AT4G39210		APL3	Glucose-1-phosphate adenylyltr...		Potri.004G157100 [exp]	30.98	0.8089	APL3.1
AT1G10240	FAR1_related	FRS11	FAR1-related sequence 11 (.1)		Potri.004G227400 [exp]	31.98	0.7678
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.017G106500 [exp]	36.33	0.7573

Compare expression of checked genes

Potri.005G071000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.