Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10310 102 / 7e-29 unknown protein AT4G37810 54 / 5e-10 unknown protein AT3G13898 47 / 7e-08 unknown protein AT4G14723 42 / 8e-06 EPFL4, CLL2 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein AT3G22820 41 / 2e-05 EPFL5, CLL1 epidermal patterning factor like 5, CHALLAH-LIKE 1, allergen-related (.1) AT2G30370 41 / 3e-05 EPFL6, CHAL EPF1-like 6, CHALLAH, allergen-related (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G095400 [exp] 166 / 5e-54 AT5G10310 105 / 2e-30 unknown protein Potri.002G112900 [exp] 63 / 3e-13 AT4G37810 90 / 9e-24 unknown protein Potri.003G042300 [exp] 61 / 8e-13 AT3G13898 80 / 4e-20 unknown protein Potri.018G130700 [exp] 46 / 4e-07 AT1G80133 62 / 1e-13 unknown protein Potri.008G157300 [exp] 43 / 6e-06 AT4G14723 69 / 4e-16 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Potri.013G155500 [exp] 40 / 9e-05 AT2G30370 93 / 7e-25 EPF1-like 6, CHALLAH, allergen-related (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025740 [exp] 107 / 3e-31 AT5G10310 100 / 2e-28 unknown protein Lus10035922 [exp] 106 / 1e-30 AT5G10310 100 / 2e-28 unknown protein Lus10006016 [exp] 64 / 9e-13 AT3G13898 76 / 4e-17 unknown protein Lus10008387 [exp] 61 / 2e-12 AT3G13898 76 / 9e-19 unknown protein Lus10011591 [exp] 54 / 6e-10 AT4G37810 102 / 6e-29 unknown protein Lus10019254 [exp] 45 / 7e-07 AT4G37810 74 / 5e-18 unknown protein Lus10006616 [exp] 43 / 1e-06 AT4G14723 99 / 5e-29 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Lus10007240 [exp] 45 / 2e-06 AT4G37810 75 / 2e-17 unknown protein Lus10028241 [exp] 44 / 2e-06 AT4G37810 74 / 2e-18 unknown protein Lus10011570 [exp] 41 / 3e-05 AT4G37810 79 / 8e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G073700.1 pacid=42805264 polypeptide=Potri.005G073700.1.p locus=Potri.005G073700 ID=Potri.005G073700.1.v4.1 annot-version=v4.1 ATGGGTTCTTGTCGCCTGTTACCTGCCTCTAGATCACTAGTGCTAACTACTGCAATTTCCATATATTTTCTGCTCTATCCGGTCTCTTGTTTTGATCAAC ACTTACAACCTCCAACTTCTCCTCGCAAGGGTATAGCTTTTGAGGAGAAGGCAAGGCTAGGTTCGACCCCACCAAGTTGCCACAACAAATGCAATGGTTG CCACCCATGCATAGCAGTTCAAGTACCAGCTCTACCGAGTCAAAACGAACCAGTTCAAATGGGTTCAGCTAAAACTAGCAGTATTGATGAGTTCTTCGAC TCGTATCCTGCAGGTAATAGGTTCCCAGATTATAGGCCACTTGGTTGGAAATGTCGCTGTGCTGACCATTTCTACAATCCCTTAACTTAA
AA sequence Show only first row Show all	>Potri.005G073700.1 pacid=42805264 polypeptide=Potri.005G073700.1.p locus=Potri.005G073700 ID=Potri.005G073700.1.v4.1 annot-version=v4.1 MGSCRLLPASRSLVLTTAISIYFLLYPVSCFDQHLQPPTSPRKGIAFEEKARLGSTPPSCHNKCNGCHPCIAVQVPALPSQNEPVQMGSAKTSSIDEFFD SYPAGNRFPDYRPLGWKCRCADHFYNPLT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G10310			unknown protein		Potri.005G073700 [exp]	0	1
AT4G20970	bHLH	bHLH162	basic helix-loop-helix (bHLH) ...		Potri.012G079100 [exp]	6.16	0.8563
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.015G032100 [exp]	15.65	0.8585	TPS1.4
					Potri.001G388100 [exp]	21.49	0.8499
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Potri.013G157400 [exp]	32.31	0.8462
AT4G27290			S-locus lectin protein kinase ...		Potri.011G125801 [exp]	34.64	0.8453
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Potri.005G106100 [exp]	35.42	0.8460	Pt-CTS2.5
AT3G25180		CYP82G1	cytochrome P450, family 82, su...		Potri.013G125300 [exp]	43.71	0.8432	Pt-CYP82.15
AT3G06470			GNS1/SUR4 membrane protein fam...		Potri.003G019800 [exp]	54.09	0.8345
AT4G14930			Survival protein SurE-like pho...		Potri.010G088100 [exp]	54.77	0.8374
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Potri.002G150500 [exp]	59.16	0.7834	CYP76.3

Compare expression of checked genes

Potri.005G073700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.