Potri.005G076700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39740 328 / 9e-114 HCC2 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
AT3G08950 154 / 8e-45 HCC1 homologue of the copper chaperone SCO1, electron transport SCO1/SenC family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G091300 439 / 6e-158 AT4G39740 310 / 1e-106 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Potri.016G118700 168 / 1e-50 AT3G08950 352 / 1e-121 homologue of the copper chaperone SCO1, electron transport SCO1/SenC family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016805 338 / 7e-118 AT4G39740 328 / 9e-114 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Lus10002848 97 / 5e-25 AT3G08950 170 / 4e-53 homologue of the copper chaperone SCO1, electron transport SCO1/SenC family protein (.1)
Lus10022501 79 / 2e-18 AT4G39740 76 / 3e-17 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF02630 SCO1-SenC SCO1/SenC
Representative CDS sequence
>Potri.005G076700.1 pacid=42805517 polypeptide=Potri.005G076700.1.p locus=Potri.005G076700 ID=Potri.005G076700.1.v4.1 annot-version=v4.1
ATGCCCATTTCCCGCTATCTTTTCTTTTCCACCAAACAACGCCCAGGACAGTGTCTCAATCTACTCCGAAGGCTTGGTCCATCAAAGAGGGTTCAATCTA
GCTGTTTTTCCAAATCAACAAACCAAAATCACTGGAAGCGTCCTGTACCGCAAGTAAAAGTAGAACTGAAGGCTCCTCGTTTCCTTGTCATTCCAGCTGC
TGTACTAGGATTTGTTGGATTGGCAGCTTTTGTGCATTATAATGACGAGAGGAGAGCGGTTCCAAAAGGTCAAGGCAGTGATTGCGTCAATGTCAAGGGT
CCGATTATTGGTGGTCCATTCACCCTAGTTAACACAGAGAATAAAGTAGTTACGGAGAAAGATTTTCTAGGAAATTGGGTTTTGCTGTACTTTGGCTATA
CATCCTCCCCTGATATTGGACCTGAGCAACTGAAATTGATCACCAAGGCCTTAAACACATTAGAGTCTAAAGAGAATCTTAAGGTTTTGCCAATGTTTGT
TACACTTGATCCTCAGCGTGACAACCCCCCACATCTTCGTGCTTACCTTGAAGAGTTTGAATCAAGAATAGTAGGATTAACAGGACCTGTTGGTGCTATA
AGACAGATGGCACAAGAGTACCGTGTTTATTTCAGGAAAGTTGAAGAAGAAGGAGATGATTATCTTGTCGAGACTTCTCATAACATGTATTTGATAAATC
CAAACATGGAGGTTGTAAAATGCTTCGGTGTCGAATATAACGCAGAGGAGCTTTCAGAAGCAATAGGAAAAGAATTGAAGAGAACCTCATCATAA
AA sequence
>Potri.005G076700.1 pacid=42805517 polypeptide=Potri.005G076700.1.p locus=Potri.005G076700 ID=Potri.005G076700.1.v4.1 annot-version=v4.1
MPISRYLFFSTKQRPGQCLNLLRRLGPSKRVQSSCFSKSTNQNHWKRPVPQVKVELKAPRFLVIPAAVLGFVGLAAFVHYNDERRAVPKGQGSDCVNVKG
PIIGGPFTLVNTENKVVTEKDFLGNWVLLYFGYTSSPDIGPEQLKLITKALNTLESKENLKVLPMFVTLDPQRDNPPHLRAYLEEFESRIVGLTGPVGAI
RQMAQEYRVYFRKVEEEGDDYLVETSHNMYLINPNMEVVKCFGVEYNAEELSEAIGKELKRTSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G39740 HCC2 homologue of copper chaperone ... Potri.005G076700 0 1
AT1G63780 IMP4 Ribosomal RNA processing Brix ... Potri.003G201100 6.24 0.8236 Pt-IMP4.2
AT5G10920 L-Aspartase-like family protei... Potri.002G106200 12.72 0.7947
AT5G54930 AT hook motif-containing prote... Potri.011G138700 16.97 0.8197
AT5G66360 DIM1B adenosine dimethyl transferase... Potri.018G018900 18.33 0.7890
AT4G25200 ATHSP23.6-MITO mitochondrion-localized small ... Potri.003G075900 18.97 0.7677
AT1G22920 CSN5A, JAB1, AJ... ARABIDOPSIS JAB1 HOMOLOG 1, CO... Potri.006G275100 19.62 0.7629 Pt-AJH1.2
AT5G62810 ATPEX14, PED2, ... PEROXISOME DEFECTIVE 2, peroxi... Potri.015G076100 24.28 0.7876
AT3G18760 Translation elongation factor... Potri.018G113200 28.61 0.7639
AT5G61770 PPAN PETER PAN-like protein (.1.2.3... Potri.002G204900 32.72 0.7673
AT5G66180 S-adenosyl-L-methionine-depend... Potri.007G056800 33.58 0.7416

Potri.005G076700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.