Potri.005G076900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22170 214 / 6e-72 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
AT4G39730 213 / 3e-71 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
AT5G65158 146 / 5e-46 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
AT5G07190 47 / 1e-06 ATS3 seed gene 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G091100 283 / 4e-99 AT4G39730 200 / 2e-66 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Potri.005G077000 268 / 2e-93 AT4G39730 218 / 3e-73 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Potri.007G091000 259 / 9e-90 AT2G22170 216 / 1e-72 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Potri.003G107100 182 / 3e-59 AT4G39730 166 / 1e-52 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Potri.010G214400 43 / 3e-05 AT5G62200 93 / 7e-24 Embryo-specific protein 3, (ATS3) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037491 219 / 2e-73 AT2G22170 221 / 3e-74 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Lus10006497 219 / 2e-73 AT2G22170 219 / 1e-73 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Lus10009020 177 / 4e-57 AT2G22170 186 / 2e-60 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0321 PLAT PF01477 PLAT PLAT/LH2 domain
Representative CDS sequence
>Potri.005G076900.1 pacid=42804194 polypeptide=Potri.005G076900.1.p locus=Potri.005G076900 ID=Potri.005G076900.1.v4.1 annot-version=v4.1
ATGTCTGTCACCACTCTCCACCTCTCTCTCATCCCCTTCCTCTTCCTCTCCCTCGCCACCATAGCATTTTCTGATGAAGACTGTGTATACACAGTGTACA
TAAGAACAGGATCCATCATCAAAGGAGGCACGGACTCCATCATAAGCGTTAGACTGTACGACTCTTATGGTAAGGGCTTGGAGGTCCCAGATCTTGAGAG
ATGGGGAGGGCTAATGGAGCCAGGTCACAACTACTTCGAGAGGGGCAATTTGGACATTTTTAGTGGAAGAGCACCATGTTTGAGTTCACCAGTGTGTGCA
TTGAACTTGACATCTGATGGGTCAGGTTCAGGCCATGGTTGGTACGTTAACTACGTGGAGGTGACTACAACTGGGGTCCATGCGGCTTGTTCACAAAAGC
AGTTCACCATTGAGCAGTGGCTGGCTCTTGATACTTCGCCTTATGAGTTAACTGCTATTAGGAATTATTGTGATTATCCTGATGTTAAGAAATCTGCCGG
AGCTTCATTCATGTGA
AA sequence
>Potri.005G076900.1 pacid=42804194 polypeptide=Potri.005G076900.1.p locus=Potri.005G076900 ID=Potri.005G076900.1.v4.1 annot-version=v4.1
MSVTTLHLSLIPFLFLSLATIAFSDEDCVYTVYIRTGSIIKGGTDSIISVRLYDSYGKGLEVPDLERWGGLMEPGHNYFERGNLDIFSGRAPCLSSPVCA
LNLTSDGSGSGHGWYVNYVEVTTTGVHAACSQKQFTIEQWLALDTSPYELTAIRNYCDYPDVKKSAGASFM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G22170 Lipase/lipooxygenase, PLAT/LH2... Potri.005G076900 0 1
AT1G18650 PDCB3 plasmodesmata callose-binding ... Potri.012G065750 5.09 0.8718
AT3G58100 PDCB5 plasmodesmata callose-binding ... Potri.013G119500 6.08 0.8785
AT5G18800 Cox19-like CHCH family protein... Potri.008G196600 17.17 0.8673
AT1G26355 SP1L1 SPIRAL1-like1 (.1) Potri.015G059100 17.66 0.8644
AT5G65020 ANNAT2 annexin 2 (.1.2) Potri.007G092500 17.88 0.8514 ANN1.2
AT2G36830 TIP1;1, GAMMA-T... TONOPLAST INTRINSIC PROTEIN 1;... Potri.006G121700 19.62 0.8619 Pt-TIP2.7
AT5G52840 NADH-ubiquinone oxidoreductase... Potri.004G071900 20.42 0.8711
AT5G15350 AtENODL17 early nodulin-like protein 17 ... Potri.017G088600 20.49 0.8684
AT3G11950 ATHST TRAF-like superfamily protein ... Potri.016G062900 20.97 0.8166
AT3G17940 Galactose mutarotase-like supe... Potri.012G045875 24.65 0.8378

Potri.005G076900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.