Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G08685 165 / 5e-53 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G10130 151 / 2e-47 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 113 / 2e-32 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT1G29140 103 / 1e-28 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 103 / 2e-28 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 99 / 6e-27 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 42 / 5e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G28290 39 / 0.0007 AGP31 arabinogalactan protein 31 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G090100 [exp] 282 / 3e-99 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 169 / 1e-54 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 145 / 5e-45 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 126 / 1e-37 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 112 / 5e-32 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 48 / 4e-07 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 47 / 2e-06 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 45 / 5e-06 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 43 / 2e-05 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026040 [exp] 187 / 2e-61 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041707 [exp] 179 / 3e-58 AT5G10130 150 / 9e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014332 [exp] 178 / 5e-58 AT5G10130 154 / 2e-48 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042201 [exp] 139 / 1e-42 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 136 / 2e-41 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 112 / 7e-32 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013908 [exp] 111 / 2e-29 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10013681 [exp] 101 / 1e-27 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10028134 [exp] 100 / 2e-27 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 100 / 3e-27 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [poplar] [flax] Transthyretin PF01190 [poplar] [flax] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Potri.005G078200.1 pacid=42804888 polypeptide=Potri.005G078200.1.p locus=Potri.005G078200 ID=Potri.005G078200.1.v4.1 annot-version=v4.1 ATGGCTAGGCTGTTACTATTTGCCTTGTGTGTGCTCCCTTCACTTGTTAGCGCATGGAGAATGGGAAACCCTTTCCATGTCCGAGGCCGCGTCTACTGTG ACACTTGCCAGTGTGGCTTCGAGACAAAAAAAACTACTTACATATCAGGTGCAACGGTTAGAATTGAATGCAAAGACAGAACAGACTTACAACTTAGATA CAGTATGGAGGGTGTGACAGACTCAACCGGGGCATACAAGATTAAGGTTGTGGGCGACCAAGCGGACAGGATTTGCCATGTTGTTCTTGTTGATAGTCCA CTGGCTGACTGCAAAACGGTACACCCAGTACGCAACCGTGCTGAAGTTATTCTAACCCGTTCCAACGGTGCCATTTCTGATCTTCATTACGCTAATTCCT TGGGGTTTGTGAAAGACGAGGCATTGCCTGGGTGTGCTGAATTGGTCAAGAAACTTCTAGAATCCGATGAATAG
AA sequence Show only first row Show all	>Potri.005G078200.1 pacid=42804888 polypeptide=Potri.005G078200.1.p locus=Potri.005G078200 ID=Potri.005G078200.1.v4.1 annot-version=v4.1 MARLLLFALCVLPSLVSAWRMGNPFHVRGRVYCDTCQCGFETKKTTYISGATVRIECKDRTDLQLRYSMEGVTDSTGAYKIKVVGDQADRICHVVLVDSP LADCKTVHPVRNRAEVILTRSNGAISDLHYANSLGFVKDEALPGCAELVKKLLESDE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Potri.005G078200 [exp]	0	1
AT1G15125			S-adenosyl-L-methionine-depend...		Potri.012G049900 [exp]	11.40	0.9008
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.016G021500 [exp]	11.74	0.9007
AT5G25460			Protein of unknown function, D...		Potri.001G174400 [exp]	12.32	0.8881
AT1G68040			S-adenosyl-L-methionine-depend...		Potri.008G136300 [exp]	14.96	0.8920
AT1G06330			Heavy metal transport/detoxifi...		Potri.019G107500 [exp]	16.79	0.8917
AT2G43480			Peroxidase superfamily protein...		Potri.007G132800 [exp]	19.07	0.8898
AT4G37710			VQ motif-containing protein (....		Potri.007G006200 [exp]	21.90	0.8918
AT3G47400			Plant invertase/pectin methyle...		Potri.012G126900 [exp]	24.49	0.7869
AT5G20260			Exostosin family protein (.1)		Potri.006G064600 [exp]	25.47	0.8833
					Potri.004G009800 [exp]	26.83	0.8796

Compare expression of checked genes

Potri.005G078200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.