Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 157 / 4e-50 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 156 / 1e-49 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 151 / 1e-47 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT5G66110 136 / 8e-42 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 133 / 2e-40 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT4G38580 133 / 2e-40 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT4G35060 117 / 2e-34 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 93 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G087300 [exp] 233 / 4e-80 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 172 / 1e-55 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 170 / 4e-55 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 169 / 6e-55 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 162 / 8e-52 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 150 / 4e-47 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G175400 [exp] 147 / 7e-46 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 138 / 1e-42 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G110400 [exp] 132 / 7e-40 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016436 [exp] 219 / 2e-74 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 218 / 7e-74 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 206 / 4e-69 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10016812 [exp] 185 / 7e-61 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1) Lus10039419 [exp] 181 / 2e-59 AT4G08570 215 / 5e-73 Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 161 / 2e-51 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 157 / 6e-50 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10014120 [exp] 150 / 3e-47 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10042946 [exp] 150 / 5e-47 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10019789 [exp] 150 / 5e-47 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.005G079800.1 pacid=42802647 polypeptide=Potri.005G079800.1.p locus=Potri.005G079800 ID=Potri.005G079800.1.v4.1 annot-version=v4.1 ATGGGAGTTAGTGGCACTTTGGAGTATTTATCTGACTTGGTGGGAAGTGGAGGCCATAAACACAAGAAGAAGAAGCAGTTACAGACTGTTGAGCTTAAGG TCAGGATGGACTGTGATGGCTGTGAACTTAAGGTCAAGAAGGCCATTTCTTCATTGAGTGGAGTTAAAAAGGTGGAGATCAACAGAAAACAACAAAGGGT GACTGTTACAGGATATGTTGATTCAAGTAAGGTGTTGAAGAAGGCAAAGTCAACAGGGAAAAAGGCAGAGATTTGGCCGTATGTTCCTTACAATTTAGTG GCTCAACCTTACGCTGTTCAGGCTTATGACAAGAAGGCTCCTCCTGGTTATGTCAGGAATGTAGAAAACACTGTCACCACAGGCACCGTGACCAGATATG ATCAGGACCCCTACACCTCCATGTTCAGTGACGACAACCCAAATGCTTGCTCTATCATGTAA
AA sequence Show only first row Show all	>Potri.005G079800.1 pacid=42802647 polypeptide=Potri.005G079800.1.p locus=Potri.005G079800 ID=Potri.005G079800.1.v4.1 annot-version=v4.1 MGVSGTLEYLSDLVGSGGHKHKKKKQLQTVELKVRMDCDGCELKVKKAISSLSGVKKVEINRKQQRVTVTGYVDSSKVLKKAKSTGKKAEIWPYVPYNLV AQPYAVQAYDKKAPPGYVRNVENTVTTGTVTRYDQDPYTSMFSDDNPNACSIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G39700			Heavy metal transport/detoxifi...		Potri.005G079800 [exp]	0	1
					Potri.007G076600 [exp]	4.58	0.9257
AT3G05660		AtRLP33	receptor like protein 33 (.1)		Potri.012G027400 [exp]	8.24	0.9079
AT5G17680			disease resistance protein (TI...		Potri.019G113701 [exp]	11.74	0.8978
					Potri.002G021100 [exp]	13.11	0.9192
AT4G13010			Oxidoreductase, zinc-binding d...		Potri.001G452600 [exp]	14.07	0.8870
AT3G10080			RmlC-like cupins superfamily p...		Potri.010G238100 [exp]	23.62	0.8904
AT3G23440		EDA6, MEE37	MATERNAL EFFECT EMBRYO ARREST ...		Potri.010G068800 [exp]	36.20	0.8745
AT5G06720		ATPA2	peroxidase 2 (.1)		Potri.016G058200 [exp]	36.49	0.8750	HPOX14.2
AT1G70740			Protein kinase superfamily pro...		Potri.008G132300 [exp]	36.93	0.8482
					Potri.002G101101 [exp]	38.45	0.8755

Compare expression of checked genes

Potri.005G079800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.