Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15100 75 / 2e-17 RHA2A RING-H2 finger A2A (.1) AT2G01150 71 / 5e-16 RHA2B RING-H2 finger protein 2B (.1) AT3G61460 67 / 3e-14 BRH1 brassinosteroid-responsive RING-H2 (.1) AT3G16720 68 / 5e-14 ATL2 TOXICOS EN LEVADURA 2 (.1) AT1G72200 68 / 7e-14 RING/U-box superfamily protein (.1) AT5G05810 68 / 7e-14 ATL43 RING/U-box superfamily protein (.1) AT2G04240 65 / 1e-13 XERICO RING/U-box superfamily protein (.1.2) AT1G35630 67 / 2e-13 Protease-associated (PA) RING/U-box zinc finger family protein (.1) AT4G11360 64 / 2e-13 RHA1B RING-H2 finger A1B (.1) AT4G09120 66 / 3e-13 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G086300 [exp] 258 / 2e-89 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1) Potri.007G086100 [exp] 161 / 3e-51 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1) Potri.005G081300 [exp] 158 / 4e-50 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1) Potri.007G086200 [exp] 150 / 4e-47 AT1G15100 74 / 5e-17 RING-H2 finger A2A (.1) Potri.010G010500 [exp] 78 / 1e-17 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1) Potri.008G219200 [exp] 75 / 1e-16 AT3G16720 197 / 2e-61 TOXICOS EN LEVADURA 2 (.1) Potri.003G130900 [exp] 71 / 6e-16 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1) Potri.001G101000 [exp] 69 / 5e-15 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1) Potri.013G073500 [exp] 70 / 1e-14 AT3G03550 262 / 2e-85 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019685 [exp] 74 / 4e-17 AT5G43200 62 / 4e-12 Zinc finger, C3HC4 type (RING finger) family protein (.1) Lus10016428 [exp] 73 / 9e-17 AT5G45290 59 / 2e-11 RING/U-box superfamily protein (.1.2) Lus10013475 [exp] 73 / 1e-16 AT2G01150 104 / 2e-29 RING-H2 finger protein 2B (.1) Lus10007936 [exp] 72 / 1e-16 AT2G01150 104 / 3e-29 RING-H2 finger protein 2B (.1) Lus10019686 [exp] 73 / 2e-16 AT1G72310 62 / 1e-11 RING/U-box superfamily protein (.1) Lus10003617 [exp] 72 / 5e-16 AT2G01150 63 / 6e-13 RING-H2 finger protein 2B (.1) Lus10023617 [exp] 74 / 8e-16 AT5G05810 219 / 1e-68 RING/U-box superfamily protein (.1) Lus10016427 [exp] 71 / 2e-15 AT1G72310 59 / 4e-11 RING/U-box superfamily protein (.1) Lus10025338 [exp] 69 / 4e-15 AT4G17905 99 / 4e-25 RING/U-box superfamily protein (.1) Lus10032290 [exp] 68 / 1e-14 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.005G081200.1 pacid=42804121 polypeptide=Potri.005G081200.1.p locus=Potri.005G081200 ID=Potri.005G081200.1.v4.1 annot-version=v4.1 ATGGCCTCTCTCTCTGAGTTCTTCTCCCACCTATATACCATGGCCATAGTTTTCCTCAGTCTTCTACTCCTTGAGATTGTAATTTTAATCCGGTCGGTCA TCGGAAGCACCTTGAAGTCCGATAAACCAATAATTAGCACCACTCAGTACCTTAGACACATCGAAGAAAAGAATCCAACAATTTCTTACAGTAAACAATT GATGAGGCAGCAAGATTCAATAGAATGCGCGGTATGCTTGTCCGAATTTTCGGAAGGCGAAAGTGTAAGGAAGTTGAAATGCAAGCATACGTTCCACAAG GATTGCTTAGACGAATGGTTGCAACAATGTTTGGCTACATGCCCACTTTGCAGAGCTAAGGTTTTGCCGGATGAGATTTTAGCCAAGTATGATCGGATGC AGAGTCAGATAGAGTATGATGGGAGTGATGAAGAGATGATTTTCATGTTATCTGCTCTACATGGTAACAGTCTACAAAGAATTTTTTAG
AA sequence Show only first row Show all	>Potri.005G081200.1 pacid=42804121 polypeptide=Potri.005G081200.1.p locus=Potri.005G081200 ID=Potri.005G081200.1.v4.1 annot-version=v4.1 MASLSEFFSHLYTMAIVFLSLLLLEIVILIRSVIGSTLKSDKPIISTTQYLRHIEEKNPTISYSKQLMRQQDSIECAVCLSEFSEGESVRKLKCKHTFHK DCLDEWLQQCLATCPLCRAKVLPDEILAKYDRMQSQIEYDGSDEEMIFMLSALHGNSLQRIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15100		RHA2A	RING-H2 finger A2A (.1)		Potri.005G081200 [exp]	0	1
AT3G62020		GLP10	germin-like protein 10 (.1.2)		Potri.002G184900 [exp]	2.82	0.8470	GLP10.1
AT4G15470			Bax inhibitor-1 family protein...		Potri.008G199200 [exp]	3.46	0.8476
AT5G53200	MYB	TRY	TRIPTYCHON, Homeodomain-like s...		Potri.002G168900 [exp]	10.00	0.7837
AT3G55830		EPC1	ECTOPICALLY PARTING CELLS, Nuc...		Potri.008G065800 [exp]	11.61	0.7768
AT3G06035			Glycoprotein membrane precurso...		Potri.008G195000 [exp]	14.69	0.8134
AT1G71910			unknown protein		Potri.013G114000 [exp]	20.49	0.7575
AT1G22410			Class-II DAHP synthetase famil...		Potri.005G162800 [exp]	20.97	0.7740	DHS4
AT5G47120		ATBI-1, ATBI1	ARABIDOPSIS BAX INHIBITOR 1, B...		Potri.001G151800 [exp]	30.85	0.7392	ATBI.1
AT1G48840			Plant protein of unknown funct...		Potri.012G055800 [exp]	32.72	0.6885
AT5G12870	MYB	ATMYB46	myb domain protein 46 (.1)		Potri.001G258700 [exp]	33.15	0.7824

Compare expression of checked genes

Potri.005G081200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.