Potri.005G081300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G01150 75 / 2e-17 RHA2B RING-H2 finger protein 2B (.1)
AT1G63840 71 / 6e-16 RING/U-box superfamily protein (.1)
AT2G04240 70 / 2e-15 XERICO RING/U-box superfamily protein (.1.2)
AT1G15100 69 / 2e-15 RHA2A RING-H2 finger A2A (.1)
AT1G72310 70 / 1e-14 ATL3 RING/U-box superfamily protein (.1)
AT3G61460 67 / 2e-14 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT4G30370 67 / 3e-14 RING/U-box superfamily protein (.1)
AT4G00305 65 / 5e-14 RING/U-box superfamily protein (.1)
AT4G10160 64 / 8e-13 RING/U-box superfamily protein (.1)
AT4G11360 63 / 8e-13 RHA1B RING-H2 finger A1B (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G086200 240 / 2e-82 AT1G15100 74 / 5e-17 RING-H2 finger A2A (.1)
Potri.007G086100 209 / 2e-70 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1)
Potri.007G086300 171 / 5e-55 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.005G081200 163 / 6e-52 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1)
Potri.010G010500 74 / 6e-16 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Potri.001G162000 71 / 3e-15 AT1G53820 149 / 2e-43 RING/U-box superfamily protein (.1)
Potri.003G130900 69 / 4e-15 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1)
Potri.008G219200 71 / 5e-15 AT3G16720 197 / 2e-61 TOXICOS EN LEVADURA 2 (.1)
Potri.010G133300 68 / 5e-15 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016428 72 / 2e-16 AT5G45290 59 / 2e-11 RING/U-box superfamily protein (.1.2)
Lus10032290 72 / 5e-16 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 71 / 9e-16 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10019686 68 / 2e-14 AT1G72310 62 / 1e-11 RING/U-box superfamily protein (.1)
Lus10019685 67 / 2e-14 AT5G43200 62 / 4e-12 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Lus10003617 67 / 2e-14 AT2G01150 63 / 6e-13 RING-H2 finger protein 2B (.1)
Lus10017510 67 / 3e-14 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1)
Lus10016427 67 / 3e-14 AT1G72310 59 / 4e-11 RING/U-box superfamily protein (.1)
Lus10028773 66 / 5e-14 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1)
Lus10013475 65 / 1e-13 AT2G01150 104 / 2e-29 RING-H2 finger protein 2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.005G081300.1 pacid=42805508 polypeptide=Potri.005G081300.1.p locus=Potri.005G081300 ID=Potri.005G081300.1.v4.1 annot-version=v4.1
ATGGCAGCTCTCTTGAAAGTCTTCTCTCACCTCTACACCGCTATCATGTCCTCCTTCAATCTCATACTCCTCAAGACCCTATTTCTAATCCGGTCCCTCC
TCCCCGGAAGTAAGCTCACGAATCCTGATAAGCTATTTCTCATTATTTCCACACAATATCTCAGCCTCATTGAAAAAACAAATCCAGCAATTCATTACAG
TGAGAAATTCAGCCGGCAGCAATCAAGAGAATGTGCGGTATGCTTATCGGGATTTATGAAAGGCGAAAGGGTTAGGAAATTGAGATGCAATCACACGTTC
CACAAGGAGTGTTTAGACAAATGGTTACAGCTATATCTGGCTACATGCCCACTTTGCAGGACTAGGGTTTTGCCAGATGAGATTGTGGTCAATTATCATC
AGCTGCAAGATATTATACGGAACGGTGGGAGCTATGATGATACCATGTTCTTGTTATCTGCGTTATATGGTAATAGTTTGAAAAAACTTTTCTAA
AA sequence
>Potri.005G081300.1 pacid=42805508 polypeptide=Potri.005G081300.1.p locus=Potri.005G081300 ID=Potri.005G081300.1.v4.1 annot-version=v4.1
MAALLKVFSHLYTAIMSSFNLILLKTLFLIRSLLPGSKLTNPDKLFLIISTQYLSLIEKTNPAIHYSEKFSRQQSRECAVCLSGFMKGERVRKLRCNHTF
HKECLDKWLQLYLATCPLCRTRVLPDEIVVNYHQLQDIIRNGGSYDDTMFLLSALYGNSLKKLF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G01150 RHA2B RING-H2 finger protein 2B (.1) Potri.005G081300 0 1
AT5G60700 glycosyltransferase family pro... Potri.009G010900 4.00 0.9465
AT3G20340 unknown protein Potri.011G003100 4.12 0.9486
AT1G73325 Kunitz family trypsin and prot... Potri.019G122100 6.48 0.9368
AT5G60700 glycosyltransferase family pro... Potri.004G212000 6.92 0.9330
AT1G30320 Remorin family protein (.1) Potri.001G358600 7.21 0.8981
AT1G73325 Kunitz family trypsin and prot... Potri.019G124500 10.39 0.9263
AT5G57500 Galactosyltransferase family p... Potri.018G094000 10.48 0.9215
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Potri.002G098400 12.24 0.9318 AT2.2
AT5G06710 HD HAT14 homeobox from Arabidopsis thal... Potri.009G023600 14.42 0.7937
AT5G50080 AP2_ERF ERF110 ethylene response factor 110 ... Potri.002G065600 14.49 0.9159

Potri.005G081300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.