Potri.005G084100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G081650 92 / 1e-25 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.005G084100.1 pacid=42804895 polypeptide=Potri.005G084100.1.p locus=Potri.005G084100 ID=Potri.005G084100.1.v4.1 annot-version=v4.1
ATGGTGCTGGATCATCCATTGACTCGTCTAGGGACTGCAGAAAGTTTGCAGGCACAAGCTATATATAAAAGCTCCTATGGGTCATCTTTGACTGCTGAAA
CCAAGAAAGTGCGTGTAATGGAGAAACTTGCACAAGATCTGAAGAGAGGATTCCTCAATCTATTTGAAGCTATCAGAGGTAGCAGAACCTCTCAAGGAAA
TGAAAACGGGGATGAAGCCACGTCAGAATCAGTGGAGGAAGTAACTGTACAAGACAGAGGCGTCAAAGTCACAGCCAGGGGTCCAAAACGCCCAGGGGTG
CCCAAAGGTCCACCCCCTAAGAATGCTTGA
AA sequence
>Potri.005G084100.1 pacid=42804895 polypeptide=Potri.005G084100.1.p locus=Potri.005G084100 ID=Potri.005G084100.1.v4.1 annot-version=v4.1
MVLDHPLTRLGTAESLQAQAIYKSSYGSSLTAETKKVRVMEKLAQDLKRGFLNLFEAIRGSRTSQGNENGDEATSESVEEVTVQDRGVKVTARGPKRPGV
PKGPPPKNA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G084100 0 1
AT5G06740 Concanavalin A-like lectin pro... Potri.001G455500 4.35 0.7280
AT3G06890 unknown protein Potri.010G013100 8.83 0.7165
AT3G12740 ALIS1 ALA-interacting subunit 1 (.1) Potri.010G173900 9.38 0.7159
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Potri.006G044600 9.79 0.6794 ERD15.1
AT2G33580 Protein kinase superfamily pro... Potri.005G128401 9.89 0.7051
AT4G15020 hAT transposon superfamily (.1... Potri.018G145554 13.49 0.7227
AT1G12990 beta-1,4-N-acetylglucosaminylt... Potri.010G046900 14.73 0.6419
AT4G34880 Amidase family protein (.1) Potri.009G130400 19.49 0.6914
AT5G54400 S-adenosyl-L-methionine-depend... Potri.011G128300 19.74 0.6750
AT4G38240 GNTI, CGL1 N-ACETYLGLUCOSAMINYLTRANSFERAS... Potri.009G168000 23.66 0.6142 CGL1.3

Potri.005G084100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.