Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23140 380 / 3e-135 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT1G02560 160 / 7e-48 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT5G45390 142 / 3e-41 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G66670 142 / 7e-41 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) ATCG00670 137 / 4e-40 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT1G12410 125 / 7e-35 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT4G17040 125 / 2e-34 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G11750 118 / 3e-32 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) AT1G09130 111 / 5e-29 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT1G49970 82 / 6e-18 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G071700 [exp] 437 / 7e-157 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.002G195200 [exp] 160 / 4e-48 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.014G119700 [exp] 160 / 7e-48 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.004G092100 [exp] 149 / 3e-43 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.003G103300 [exp] 145 / 5e-42 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.009G114001 [exp] 129 / 2e-36 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.004G152900 [exp] 129 / 2e-36 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.001G115900 [exp] 122 / 2e-33 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Potri.003G083300 [exp] 122 / 3e-33 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017397 [exp] 369 / 6e-131 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10010196 [exp] 369 / 1e-130 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10040981 [exp] 313 / 4e-108 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10013434 [exp] 311 / 4e-107 AT5G23140 347 / 3e-121 nuclear-encoded CLP protease P7 (.1) Lus10040982 [exp] 300 / 8e-103 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10013435 [exp] 179 / 1e-54 AT5G23140 209 / 5e-66 nuclear-encoded CLP protease P7 (.1) Lus10002422 [exp] 148 / 2e-43 AT1G02560 361 / 4e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10001450 [exp] 150 / 3e-43 AT1G02560 365 / 1e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10000063 [exp] 126 / 6e-37 AT5G23140 128 / 2e-38 nuclear-encoded CLP protease P7 (.1) Lus10007589 [exp] 129 / 5e-36 AT5G45390 293 / 2e-99 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [poplar] [flax] ClpP_crotonase PF00574 [poplar] [flax] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Potri.005G092600.1 pacid=42803007 polypeptide=Potri.005G092600.1.p locus=Potri.005G092600 ID=Potri.005G092600.1.v4.1 annot-version=v4.1 ATGAAAGCCCTCTTCTCTACCACCAAGCTCATCACTTCCACAGCTAAACCAAAACCCTCTTTTCTCTTGACCCCCAAAACCTCTACCACTAGAGCTTATA GTCTAATCCCAATGGTTATCGAACACTCTTCAAGAGGAGAAAGAGCTTATGATATATTTTCTAGGCTTTTAAAAGAGAGAATTGTCTGTATTAATGGCCC AATTAATGATGATACTTCTAATGTTGTTGTTGCTCAGCTTTTGTTTCTCGAGTCTGAGAATCCTTCTAAGCCTATCCATATGTATCTGAATTCTCCTGGT GGACATGTTACCGCAGGTCTTGCTATTTACGATACAATGCAGTACATAAGGTCTCCAGTTAATACCATTTGTTTGGGTCAAGCTGCATCTATGGCTTCTC TCCTTTTGGCTTCTGGGGCTAAGGGTGAGAGGAAGGCACTTCCAAATGCAACAATTATGATTCATCAGCCATCAGGTGGGTACAGCGGACAGGCAAAGGA TTTGACAATTCACACCAAGCAGATAGTTCGGGTCTGGGATGCACTGAATCAATTGTACTGCAAGCATACAGGGAAGCCAATTGATGTAATTCAGAAGAAT ATGGATAGAGATTATTTTATGACCCCAGAAGAGGCAAAGGAATTCGGAATTATTGATGAGGTGATTGATCAAAGACCCATGACTCTGGTGACTGATGCTG TTGGCGATGAAAGTAAACAAAAGGGTTCGAGCTAG
AA sequence Show only first row Show all	>Potri.005G092600.1 pacid=42803007 polypeptide=Potri.005G092600.1.p locus=Potri.005G092600 ID=Potri.005G092600.1.v4.1 annot-version=v4.1 MKALFSTTKLITSTAKPKPSFLLTPKTSTTRAYSLIPMVIEHSSRGERAYDIFSRLLKERIVCINGPINDDTSNVVVAQLLFLESENPSKPIHMYLNSPG GHVTAGLAIYDTMQYIRSPVNTICLGQAASMASLLLASGAKGERKALPNATIMIHQPSGGYSGQAKDLTIHTKQIVRVWDALNQLYCKHTGKPIDVIQKN MDRDYFMTPEEAKEFGIIDEVIDQRPMTLVTDAVGDESKQKGSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Potri.005G092600 [exp]	0	1
AT1G15220		ATCCMH	cytochrome c biogenesis protei...		Potri.003G052000 [exp]	3.46	0.8322
AT4G03240		ATFH, FH	frataxin homolog (.1)		Potri.013G150400 [exp]	3.46	0.8669
AT5G20130			unknown protein		Potri.016G013500 [exp]	6.70	0.8650
AT1G76860			Small nuclear ribonucleoprotei...		Potri.005G191600 [exp]	8.83	0.8154
AT3G11400		ATEIF3G1, EIF3G...	eukaryotic translation initiat...		Potri.010G199000 [exp]	29.93	0.7858
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Potri.007G071700 [exp]	30.29	0.8378
AT2G30260		U2B''	U2 small nuclear ribonucleopro...		Potri.013G153700 [exp]	33.76	0.7599
AT4G11120			translation elongation factor ...		Potri.014G172300 [exp]	39.69	0.7702
AT3G03190		ATGSTF6, ATGSTF...	ARABIDOPSIS GLUTATHIONE-S-TRAN...		Potri.002G015200 [exp]	40.64	0.7654
AT1G49880		EMB3106, AtErv1...	EMBRYO DEFECTIVE 3106, Erv1/Al...		Potri.009G090200 [exp]	47.02	0.8096

Compare expression of checked genes

Potri.005G092600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.