Plant FIBer expression Database

Potri.005G094700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19800 214 / 4e-70 Protein of unknown function (DUF177) (.1), Protein of unknown function (DUF177) (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040969
[exp]
191 / 1e-58 AT3G19800 197 / 4e-61 Protein of unknown function (DUF177) (.1), Protein of unknown function (DUF177) (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02620 YceD Large ribosomal RNA subunit accumulation protein YceD
Representative CDS sequence
>Potri.005G094700.4 pacid=42802520 polypeptide=Potri.005G094700.4.p locus=Potri.005G094700 ID=Potri.005G094700.4.v4.1 annot-version=v4.1
ATGTCAGAAGCTGGCCATTTGGTATCTGCTCAAAGCATCAAAGAATTTACTACCAACTATCCATCGAATACAAGAAGATCACAAAGGTTGACGTTTCAGA
GATCCAAAATCATAGCAGCTTCAAAAAGAAATGACTTCCCGCCGATAAGCAAGAAAAATTCCAGGGCTCCCCGCCGTTTGGTTACAATATCAACCGCAGA
TGGGAGATGGCAAGGGAAATGGACTTCTGACTACCTACTGTCTCTTCAAGACCTGAAGTTAGAAGACTTGATCGAAGATGAACAAAAAGATGCTGAGGTT
TCTGTTAATCTCTCCGTTCAAAAGCATGCCGGTTTTGGTTTCTCAGTGGATGGAAGGATCATCACATCTTTCACAAGAAAATGCAGCAACTGCTTTTCCC
CATACTGTAGAAAGATTGATACAACCTTCAATGTTTGGGTTCTTCCATCAAGAGCCAATCGTGAAGTTCATCTGCCTGACATTGGTGGCGACGACCCATC
AGTTATATACGTGAAGCCTGGATATGAAGCTGATCTTGACTCGTTGATACAAGACACACTAAGGCTTACCACCTCAGTCAAAGATACTTGCTCAGAATCG
TGCGAGAAATCCAAACCCAAATTGATACATATAGGTGGACAGAAAGCAGCTTCTATTGATAAGAGGTGGTCTATACTCTTGGAGCTGAAGAAGGAAAATT
TGTGA
AA sequence
>Potri.005G094700.4 pacid=42802520 polypeptide=Potri.005G094700.4.p locus=Potri.005G094700 ID=Potri.005G094700.4.v4.1 annot-version=v4.1
MSEAGHLVSAQSIKEFTTNYPSNTRRSQRLTFQRSKIIAASKRNDFPPISKKNSRAPRRLVTISTADGRWQGKWTSDYLLSLQDLKLEDLIEDEQKDAEV
SVNLSVQKHAGFGFSVDGRIITSFTRKCSNCFSPYCRKIDTTFNVWVLPSRANREVHLPDIGGDDPSVIYVKPGYEADLDSLIQDTLRLTTSVKDTCSES
CEKSKPKLIHIGGQKAASIDKRWSILLELKKENL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G19800 Protein of unknown function (D... Potri.005G094700
[exp]
0 1
AT5G09820 Plastid-lipid associated prote... Potri.001G309300
[exp]
1.00 0.9523
AT3G63510 FMN-linked oxidoreductases sup... Potri.001G264900
[exp]
3.16 0.9396
AT5G16810 Protein kinase superfamily pro... Potri.019G050500
[exp]
4.24 0.9260
AT5G19500 Tryptophan/tyrosine permease (... Potri.001G224950
[exp]
8.30 0.9348
AT3G62910 APG3 ALBINO AND PALE GREEN, Peptide... Potri.014G133400
[exp]
9.69 0.8781 APG3.1
AT2G03390 uvrB/uvrC motif-containing pro... Potri.010G161600
[exp]
12.32 0.9309
AT5G53170 FTSH11 FTSH protease 11 (.1) Potri.015G020700
[exp]
18.97 0.9167
AT5G27560 Domain of unknown function (DU... Potri.013G020800
[exp]
22.04 0.9135
AT1G25290 ATRBL10 RHOMBOID-like protein 10 (.1.2... Potri.003G019500
[exp]
22.36 0.8603
AT3G59780 Rhodanese/Cell cycle control p... Potri.013G128300
[exp]
22.44 0.9029

Potri.005G094700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.