Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16640 151 / 1e-42 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12300 149 / 3e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62670 144 / 1e-39 RPF2 rna processing factor 2 (.1) AT1G63150 143 / 4e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62910 142 / 6e-39 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63400 141 / 1e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12775 139 / 7e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63080 139 / 7e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62590 138 / 2e-37 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G62680 137 / 2e-37 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G130600 [exp] 231 / 4e-73 AT1G12700 330 / 3e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.014G117600 [exp] 202 / 4e-62 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G149800 [exp] 196 / 2e-58 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.019G021200 [exp] 191 / 4e-57 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G150100 [exp] 189 / 2e-56 AT1G62930 442 / 8e-149 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G271200 [exp] 184 / 2e-54 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G242500 [exp] 182 / 6e-54 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G257300 [exp] 182 / 2e-53 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074700 [exp] 179 / 4e-53 AT1G62930 481 / 1e-164 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042768 [exp] 184 / 6e-54 AT1G12700 418 / 8e-138 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10029737 [exp] 183 / 1e-53 AT1G63130 424 / 6e-140 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022861 [exp] 151 / 2e-42 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10006218 [exp] 145 / 2e-40 AT5G60230 251 / 4e-80 splicing endonuclease 2 (.1.2) Lus10024962 [exp] 140 / 2e-38 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10003447 [exp] 138 / 2e-37 AT1G12700 202 / 1e-56 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003427 [exp] 134 / 5e-37 AT1G12700 291 / 8e-92 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10036865 [exp] 135 / 1e-36 AT1G12700 273 / 1e-83 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014245 [exp] 132 / 2e-35 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10008593 [exp] 129 / 3e-34 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.005G097200.2 pacid=42803683 polypeptide=Potri.005G097200.2.p locus=Potri.005G097200 ID=Potri.005G097200.2.v4.1 annot-version=v4.1 ATGGCGATCACTCGAACAAGTGTTTTGCTGGCTAGAAATTCAATGTTTGGCATTCAACATCAAATGGATATGGCTTTGTTTTCCTCTTTTAACATTTCTC CTTGTACAAGTAGCAATAAGGTCTTGTTTAGTAAGATTGATTATGCCCTTGCTTCTTTCAACGCCATGATTGGCAGGGAACCTCTCCCTTCTATTGTCGA ATCTAATAATTTACTATCCACAGTTGTGGACGTGAAAGAATATGAGACAGTGGTTTCTTTGTCCAAACAAATGGAACTTGCTGGAATTCCTCATGATGTT TGTACTCTTTACATCTTGATCAATTGCTTCTGCCATTTACGTTGTGTTGATTCTGGGTTCCCTCTCTTGGGAAAAATCCTTAAATGCGGTTTTCAATCTG GTACTTTTACATTTACTACCTTAGTAAATGGGGTGTGTAAAGAGGGTATTTTGTATCAAGCTGTGAAACTGGTTAATGAAATGTTGGCTAAGGGATATCG ACTCAATTCATATACTTACAGCACGATCGTAAACAGCCTTTGTAAAGTTGGTAAAATCACTGAGGCAGATGGGTTGCTTGGGAAAATGAAAAGCGTAGGT TGTGTGCCAGATGTTGTTGCATACAATTCACTGATGAATGGATTTGTTTCGCGAGGGCAAATGGATGAAGCAAAAAAAAAAAAAAAAAGTATTTGGTGTG ATGGTGAGCAAGGGTGCTATGCCCAGTGTTTCTAA
AA sequence Show only first row Show all	>Potri.005G097200.2 pacid=42803683 polypeptide=Potri.005G097200.2.p locus=Potri.005G097200 ID=Potri.005G097200.2.v4.1 annot-version=v4.1 MAITRTSVLLARNSMFGIQHQMDMALFSSFNISPCTSSNKVLFSKIDYALASFNAMIGREPLPSIVESNNLLSTVVDVKEYETVVSLSKQMELAGIPHDV CTLYILINCFCHLRCVDSGFPLLGKILKCGFQSGTFTFTTLVNGVCKEGILYQAVKLVNEMLAKGYRLNSYTYSTIVNSLCKVGKITEADGLLGKMKSVG CVPDVVAYNSLMNGFVSRGQMDEAKKKKKSIWCDGEQGCYAQCF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G16640			Pentatricopeptide repeat (PPR)...		Potri.005G097200 [exp]	0	1
					Potri.010G194650 [exp]	4.47	0.8062
					Potri.005G097250 [exp]	5.00	0.7779
					Potri.011G134500 [exp]	9.00	0.8165
AT5G19485			transferases;nucleotidyltransf...		Potri.009G066400 [exp]	22.31	0.8132
AT4G40045			unknown protein		Potri.008G025700 [exp]	24.89	0.8147
AT3G15220			Protein kinase superfamily pro...		Potri.001G397600 [exp]	25.45	0.8153
AT4G31980			unknown protein		Potri.001G017900 [exp]	38.15	0.7759
AT5G55090		MAPKKK15	mitogen-activated protein kina...		Potri.003G130000 [exp]	40.42	0.7933
AT5G04000			unknown protein		Potri.016G044001 [exp]	44.09	0.8037
					Potri.004G093250 [exp]	48.98	0.7964

Compare expression of checked genes

Potri.005G097200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.