Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56090 259 / 3e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G30480 71 / 5e-14 TPR1, AtTPR1 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) AT3G25230 66 / 7e-12 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT1G62390 60 / 9e-10 CLMP1, Phox2 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) AT3G54010 56 / 2e-08 DEI1, PAS1 PASTICCINO 1, FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1.2) AT3G17970 55 / 3e-08 ATTOC64-III translocon at the outer membrane of chloroplasts 64-III (.1) AT3G07370 54 / 3e-08 ATCHIP, CHIP carboxyl terminus of HSC70-interacting protein (.1) AT5G48570 54 / 5e-08 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G58620 54 / 5e-08 TTL4 tetratricopetide-repeat thioredoxin-like 4 (.1) AT1G58450 51 / 8e-08 TPR6 tetratricopeptide repeat 6, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G100700 [exp] 71 / 7e-14 AT4G30480 303 / 8e-104 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.006G178900 [exp] 65 / 5e-12 AT4G30480 275 / 1e-92 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.002G248300 [exp] 63 / 6e-11 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.004G002900 [exp] 62 / 1e-10 AT1G62390 926 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Potri.014G149400 [exp] 61 / 3e-10 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.011G021000 [exp] 61 / 3e-10 AT1G62390 885 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Potri.001G205300 [exp] 59 / 2e-09 AT5G09420 724 / 0.0 outer membrane 64, ARABIDOPSIS THALIANA TRANSLOCON AT THE OUTER MEMBRANE OF CHLOROPLASTS 64-V, translocon at the outer membrane of chloroplasts 64-V (.1) Potri.002G117200 [exp] 56 / 1e-08 AT5G48570 553 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G166300 [exp] 52 / 2e-07 AT5G65160 436 / 5e-145 tetratricopeptide repeat 14, tetratricopeptide repeat (TPR)-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031195 [exp] 295 / 8e-100 AT1G56090 260 / 8e-87 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031774 [exp] 292 / 1e-98 AT1G56090 259 / 2e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008024 [exp] 251 / 9e-83 AT1G56090 218 / 8e-71 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10035117 [exp] 67 / 9e-13 AT4G30480 291 / 3e-99 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10031983 [exp] 67 / 5e-12 AT4G30480 222 / 9e-76 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10038216 [exp] 64 / 6e-11 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 64 / 6e-11 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10009682 [exp] 62 / 1e-10 AT3G17970 700 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Lus10018004 [exp] 60 / 8e-10 AT3G17970 711 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Lus10002338 [exp] 60 / 1e-09 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13414 [poplar] [flax] TPR_11 TPR repeat
Representative CDS sequence Show only first row Show all	>Potri.005G097300.1 pacid=42804598 polypeptide=Potri.005G097300.1.p locus=Potri.005G097300 ID=Potri.005G097300.1.v4.1 annot-version=v4.1 ATGGTGGTGATGGCAAACAAGATTGAGACAGCACATCAAATGTACAGAGATGGAAACTACGAGGAAGCGCTTGGATTTTACACAGAGGCACTTTCCATGG CTAAAACTAAGCCACAAAAGATTGCTTTGCATAGTAATAGAGCTGCTTGTTATTTGAAATTGCATGATTTCAAAAAGGCAGCTGAAGAATGTACATCAGT GCTTGAGCTTGATCACAATCACACTGGAGCATTGATGTTGCGGGCACAGACGCTAGTCACCCTTAAGGAGTACACCTCAGCACTCTTTGATGTCAATAGG CTGATGGAGTTGAATCCTTCATCAGAAGTTTACCAGAATCTTGAAGCTCGTCTGAGGACTCAATTGTCTCTTGCTCCAATACCTGAATCTGAAGTGGAGT TAGAAGAAGAGGAAGAAGATGAAAATGAAGCAGAACCGTGCGGACAAGTGGAAATGCAAGACGCAGCAACTGCACTAGTAGATATAAATCAGAAAAATGA GCCTTGTCAGACTACAAATGATGCTGAAGTTATTGTTCATAAAACACCAGACATCAAGAAGATTTCTGTGGAAAGTACAGATAAAAAATCCGAGCCAAGA AAGACCATTGCTGCTGAGGTTATTGCTCAAGCTAGGAAGAAAGTTGAGCCTAGAAAAACTTTTACTGCTGAAGTTATTGCTCAAGCACAGCGGAAGGCTG AGCCTAGAAACACTGCTCCTGCTGAAGCTGATGCTGGGACAAAAGAATCAATTAAACAGAATTCTAATGGATGGCAAGCAATCCCAAAACCAAAGGGACA CTCGACTCTGGATTATGCACGTTGGGACAGGGTTGAGGATGGCTCTAGTGAAGATGACGATGAGGAGGAGGAGGATTCTCAGCCTCAATATCGGTTCCGT GTAAGAACATTTGGTGTGTGA
AA sequence Show only first row Show all	>Potri.005G097300.1 pacid=42804598 polypeptide=Potri.005G097300.1.p locus=Potri.005G097300 ID=Potri.005G097300.1.v4.1 annot-version=v4.1 MVVMANKIETAHQMYRDGNYEEALGFYTEALSMAKTKPQKIALHSNRAACYLKLHDFKKAAEECTSVLELDHNHTGALMLRAQTLVTLKEYTSALFDVNR LMELNPSSEVYQNLEARLRTQLSLAPIPESEVELEEEEEDENEAEPCGQVEMQDAATALVDINQKNEPCQTTNDAEVIVHKTPDIKKISVESTDKKSEPR KTIAAEVIAQARKKVEPRKTFTAEVIAQAQRKAEPRNTAPAEADAGTKESIKQNSNGWQAIPKPKGHSTLDYARWDRVEDGSSEDDDEEEEDSQPQYRFR VRTFGV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G56090			Tetratricopeptide repeat (TPR)...		Potri.005G097300 [exp]	0	1
AT5G63080			2-oxoglutarate (2OG) and Fe(II...		Potri.015G080400 [exp]	2.44	0.7843
AT4G00355		ATI2	ATG8-interacting protein 2, un...		Potri.002G160700 [exp]	4.00	0.7888
AT4G01280	MYB		Homeodomain-like superfamily p...		Potri.014G089300 [exp]	4.24	0.7903
AT5G62020	HSF	AT-HSFB2A	ARABIDOPSIS THALIANA HEAT SHOC...		Potri.012G138900 [exp]	6.00	0.6949
AT1G33980		ATUPF3, UPF3	Smg-4/UPF3 family protein (.1....		Potri.004G225800 [exp]	6.32	0.7491
AT1G52080		AR791	actin binding protein family (...		Potri.001G191300 [exp]	10.39	0.7637
AT3G53690			RING/U-box superfamily protein...		Potri.013G120300 [exp]	10.95	0.7703
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.006G013000 [exp]	12.96	0.7836
					Potri.001G142300 [exp]	14.14	0.7424
AT5G23750			Remorin family protein (.1.2)		Potri.012G140800 [exp]	18.76	0.7376

Compare expression of checked genes

Potri.005G097300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.