Potri.005G099000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
AT1G76410 145 / 4e-44 ATL8 RING/U-box superfamily protein (.1)
AT2G17450 133 / 2e-39 RHA3A RING-H2 finger A3A (.1)
AT4G35480 130 / 4e-38 RHA3B RING-H2 finger A3B (.1)
AT3G18773 95 / 3e-24 RING/U-box superfamily protein (.1)
AT5G05280 94 / 3e-24 RING/U-box superfamily protein (.1)
AT1G49220 95 / 7e-24 RING/U-box superfamily protein (.1)
AT1G49200 91 / 2e-22 RING/U-box superfamily protein (.1)
AT1G49210 90 / 4e-22 RING/U-box superfamily protein (.1)
AT5G01880 84 / 2e-20 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G064401 189 / 3e-61 AT1G20823 118 / 2e-33 RING/U-box superfamily protein (.1)
Potri.002G006400 146 / 4e-44 AT1G76410 177 / 1e-56 RING/U-box superfamily protein (.1)
Potri.005G255200 140 / 8e-42 AT1G76410 163 / 2e-51 RING/U-box superfamily protein (.1)
Potri.013G091300 95 / 3e-24 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.001G309600 94 / 8e-24 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1)
Potri.019G010500 94 / 9e-24 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1)
Potri.019G057700 92 / 2e-23 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.001G309700 92 / 5e-23 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1)
Potri.019G010600 90 / 3e-22 AT1G49230 158 / 1e-48 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013210 157 / 3e-48 AT1G20823 207 / 3e-68 RING/U-box superfamily protein (.1)
Lus10030728 156 / 4e-48 AT1G20823 209 / 6e-69 RING/U-box superfamily protein (.1)
Lus10016040 147 / 2e-44 AT1G20823 202 / 4e-66 RING/U-box superfamily protein (.1)
Lus10025162 136 / 1e-40 AT1G20823 190 / 6e-62 RING/U-box superfamily protein (.1)
Lus10006788 94 / 1e-23 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1)
Lus10006787 93 / 2e-23 AT1G49230 159 / 9e-49 RING/U-box superfamily protein (.1)
Lus10005814 93 / 3e-23 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1)
Lus10005815 93 / 3e-23 AT1G49230 170 / 3e-53 RING/U-box superfamily protein (.1)
Lus10006785 91 / 1e-22 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1)
Lus10025146 89 / 3e-22 AT3G10910 128 / 8e-38 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.005G099000.1 pacid=42804879 polypeptide=Potri.005G099000.1.p locus=Potri.005G099000 ID=Potri.005G099000.1.v4.1 annot-version=v4.1
ATGCCTCGCTTTACCAGAATACTCAACACCAAGGCGGCTGAGCCACCAGCTGCGGTGAACCTGGAGTCCGACTTTGTCGTTATATTAGCAGCTCTTTTAT
GTGCATTGATATGTGTGGTGGGCCTCATAGCGGCGGCTCGCTGTGCCTGGCTCCGCCGTGTCACCGGTGGCGCCTCCAGTGGACCACCTCCTCAGGCCAA
AGCTAACAAGGGTGTGAAGAAGAAGAACCTCCAGCTTCTCCCCAGGTTCACTTACTCTGCTGGAGGTGGGGGCGCCACCACCAGTTTTGGAACAACAGAG
TGTGCAATTTGCTTAGGTGAGTTTGTTGAAGGAGATGAAGTGAGGGTTTTGCCTCAGTGTGGACATGGATTCCATGTTGGATGCATTGACAAATGGCTCG
GCTCTCATTCCTCTTGTCCCTCTTGCCGTCAGATTTTGGTGGTGGCTAGGTGTCAGAAATGTGGTCAGTTTCCTGCTTCCACCTCCTCCTCCTCTTGTGG
TGGTGGAAATGCCACTGAGGTTGAGTTGAGCACTAGAGAAGATGGCAATGCCAATGATGGTAATATAAATCGTGCCAATGATGCAGGCGCTTTCTTGCCT
TGA
AA sequence
>Potri.005G099000.1 pacid=42804879 polypeptide=Potri.005G099000.1.p locus=Potri.005G099000 ID=Potri.005G099000.1.v4.1 annot-version=v4.1
MPRFTRILNTKAAEPPAAVNLESDFVVILAALLCALICVVGLIAAARCAWLRRVTGGASSGPPPQAKANKGVKKKNLQLLPRFTYSAGGGGATTSFGTTE
CAICLGEFVEGDEVRVLPQCGHGFHVGCIDKWLGSHSSCPSCRQILVVARCQKCGQFPASTSSSSCGGGNATEVELSTREDGNANDGNINRANDAGAFLP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G20823 RING/U-box superfamily protein... Potri.005G099000 0 1
AT5G50335 unknown protein Potri.012G094000 3.16 0.7582
AT5G47510 Sec14p-like phosphatidylinosit... Potri.003G076200 20.39 0.6083
AT2G32170 S-adenosyl-L-methionine-depend... Potri.006G023400 21.67 0.5819
AT5G45580 GARP Homeodomain-like superfamily p... Potri.001G133400 23.51 0.6548
AT1G67030 C2H2ZnF ZFP6 zinc finger protein 6 (.1) Potri.014G123700 25.92 0.6312
AT1G60800 NIK3 NSP-interacting kinase 3 (.1) Potri.010G043200 29.86 0.6740
AT4G27450 Aluminium induced protein with... Potri.001G403000 34.05 0.6727
AT1G56280 ATDI19 drought-induced 19 (.1.2) Potri.012G086500 39.68 0.5745
AT5G42680 Protein of unknown function, D... Potri.002G128800 40.00 0.5898
Potri.017G040750 42.21 0.6679

Potri.005G099000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.