Plant FIBer expression Database

Potri.005G099233 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G42960 46 / 8e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G254200
[exp]
47 / 3e-08 AT1G42960 141 / 5e-43 unknown protein
Potri.007G064100
[exp]
0 / 1 AT1G42960 147 / 1e-45 unknown protein
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.005G099233.1 pacid=42803746 polypeptide=Potri.005G099233.1.p locus=Potri.005G099233 ID=Potri.005G099233.1.v4.1 annot-version=v4.1
ATGATGAGGATAAAGCTTTGGAGAGGACCCGCCAAGTTCTTACTGACACAGCTGAACTCTGCTATAGATGAGGTTTCCGCTCAGCTGCATCCAGAAGATG
CCCCCAGTGGAATTGCAGTGGCTTCTGATGAGATCCAAGCTTCCATACAAGAAAATGTCTGTCGAAATCTCAATGCAAGCTTCTATTTTTACTTGCGATC
AGCATTATAG
AA sequence
>Potri.005G099233.1 pacid=42803746 polypeptide=Potri.005G099233.1.p locus=Potri.005G099233 ID=Potri.005G099233.1.v4.1 annot-version=v4.1
MMRIKLWRGPAKFLLTQLNSAIDEVSAQLHPEDAPSGIAVASDEIQASIQENVCRNLNASFYFYLRSAL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G42960 unknown protein Potri.005G099233
[exp]
0 1
AT3G27970 Exonuclease family protein (.1... Potri.017G073300
[exp]
4.00 0.9356
AT2G25780 Protein of unknown function (D... Potri.006G237300
[exp]
8.83 0.8934
AT4G14880 OLD3, CYTACS1, ... ONSET OF LEAF DEATH 3, O-acety... Potri.008G153300
[exp]
12.04 0.8960
Potri.002G038350
[exp]
12.24 0.7722
AT1G58420 Uncharacterised conserved prot... Potri.014G006300
[exp]
12.72 0.8398
AT2G46600 Calcium-binding EF-hand family... Potri.014G101700
[exp]
18.33 0.8683
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.003G016733
[exp]
20.44 0.7868
AT3G12910 NAC NAC (No Apical Meristem) domai... Potri.007G066300
[exp]
20.97 0.8435
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Potri.008G205200
[exp]
35.56 0.8357 Pt-IFS1.42
AT2G31180 MYB ATMYB14, Myb14a... ARABIDOPSIS THALIANA MYB DOMAI... Potri.019G018200
[exp]
37.14 0.8272

Potri.005G099233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.