Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58170 49 / 2e-07 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G64160 49 / 2e-07 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21100 48 / 5e-07 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 45 / 4e-06 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 45 / 5e-06 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 45 / 8e-06 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G23690 44 / 2e-05 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G11210 43 / 3e-05 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G11190 43 / 3e-05 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 42 / 0.0001 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G100600 [exp] 179 / 2e-57 AT1G58170 54 / 4e-09 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.005G100750 [exp] 62 / 1e-12 ND / Potri.006G195300 [exp] 50 / 2e-07 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 49 / 3e-07 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G096800 [exp] 48 / 7e-07 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.013G142602 [exp] 48 / 7e-07 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G134600 [exp] 47 / 1e-06 AT1G64160 182 / 5e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060801 [exp] 46 / 2e-06 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G061000 [exp] 46 / 3e-06 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034476 [exp] 49 / 5e-07 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025067 [exp] 47 / 1e-06 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10028749 [exp] 47 / 1e-06 AT1G64160 232 / 2e-78 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 47 / 2e-06 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017539 [exp] 46 / 5e-06 AT1G64160 238 / 9e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034479 [exp] 45 / 9e-06 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025064 [exp] 44 / 1e-05 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10032939 [exp] 44 / 2e-05 AT5G42500 139 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021083 [exp] 43 / 4e-05 AT1G22900 150 / 5e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10016231 [exp] 43 / 4e-05 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF03018 [poplar] [flax] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Potri.005G100700.1 pacid=42803877 polypeptide=Potri.005G100700.1.p locus=Potri.005G100700 ID=Potri.005G100700.1.v4.1 annot-version=v4.1 ATGGCTCAAATTCTGCACCTCTATCTTCTTGCAACTCTACTTCTTGCTCTTTCTTTTAAGGCCACCTCCTCCTCCCGACACAGCGGCAACAACGGGCTCA AATCTCTCCACTTTGCACTCTACCAGCATGAAACGATAAACAAAACGGGATACATCATAGTGAATGGCGTGGCCGGAGCAGGGGTTGGTCAAACCACAAC ACCTTTCGGCACCTTGTTTGCTTTCCAAGATCCGATGACTGTGACGGCCAATATATCTTCAAAGGTCGTCGCGATTGCTGAAGGCACCTCTATAACATCT AGTTTTGACGGGCTGAGGAGCATTTCCATCGCTAAGATCACTTTGAGGTTGAAGAATCACATGGGGTCTATCTCTATTGTTGGGGGGACACATAACATCA AGCCTGCTGATCATCCCGTGGTAGGAGGCACCGGTGACTTCATGTTTGTTCAAGGGTACGTGACATCCTCTCCGGTGGATCTCCAGGGACTCACTGTTAC CTACAAGATTGTGTTCCACCTCTACTGGCCCTCCTATGCAAATAAATTCTCACTTCATGACAAACGTGTTCGAAATGATATAATTACTTAG
AA sequence Show only first row Show all	>Potri.005G100700.1 pacid=42803877 polypeptide=Potri.005G100700.1.p locus=Potri.005G100700 ID=Potri.005G100700.1.v4.1 annot-version=v4.1 MAQILHLYLLATLLLALSFKATSSSRHSGNNGLKSLHFALYQHETINKTGYIIVNGVAGAGVGQTTTPFGTLFAFQDPMTVTANISSKVVAIAEGTSITS SFDGLRSISIAKITLRLKNHMGSISIVGGTHNIKPADHPVVGGTGDFMFVQGYVTSSPVDLQGLTVTYKIVFHLYWPSYANKFSLHDKRVRNDIIT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G64160			Disease resistance-responsive ...		Potri.005G100700 [exp]	0	1
AT1G76650		CML38	calmodulin-like 38 (.1.2.3)		Potri.001G332900 [exp]	1.00	0.9603
AT1G73500		ATMKK9	MAP kinase kinase 9 (.1)		Potri.015G030700 [exp]	1.41	0.9457	Pt-MKK9.2
AT1G32350		AOX1D	alternative oxidase 1D (.1)		Potri.003G103900 [exp]	4.89	0.9342
AT1G29290			unknown protein		Potri.004G061300 [exp]	4.89	0.9333
AT4G12731			unknown protein		Potri.001G226750 [exp]	4.89	0.9295
AT4G12731			unknown protein		Potri.001G226650 [exp]	5.91	0.9285
AT3G23240	AP2_ERF	ERF1, ATERF1	ethylene response factor 1 (.1...		Potri.011G061700 [exp]	7.07	0.9302
AT5G10695			unknown protein		Potri.010G251000 [exp]	7.93	0.8917
AT2G31945			unknown protein		Potri.009G024300 [exp]	9.79	0.8906
					Potri.004G188300 [exp]	16.58	0.9042

Compare expression of checked genes

Potri.005G100700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.