Potri.005G101501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66005 270 / 1e-92 Expressed protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035990 260 / 1e-88 AT5G66005 235 / 3e-79 Expressed protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF03266 NTPase_1 NTPase
Representative CDS sequence
>Potri.005G101501.1 pacid=42803267 polypeptide=Potri.005G101501.1.p locus=Potri.005G101501 ID=Potri.005G101501.1.v4.1 annot-version=v4.1
ATGACTCCCACTATGTTCAGAGCTTGTGCTTGCCCCTCGGCATGGGGGTGTGACCCATTAGAGACAGACAGGAAAATAAAAATAAAAATGATGGCAACAG
CTCCTGGAAAATGCTTCCTGGTCACCGGCCCTCCGGGTGTAGGTAAAACCACACTGATAATGAGAGTGTTTGAAACCCTCAAAACCTCAAACCCCACCTT
GAAAATTCAAGGTTTTTACACTAGGGAGATTAGAGAAGGGATTGAGAGGGTTGGCTTTGAAGTTGTCACTTTAGATGGACGCAAAGCCCCTCTTGCCTCC
ACCACCATTTCTACCCCAGAGTCTATCAGATGGCCCACAGTTGGGAAGTATAAAGTAGACATTGCATCATTTGAGGCTCTGGCATTGCCTGAGTTGCAGA
TTAAAGAAGATACTGATCTATTCATCATCGATGAAGTTGGCAAAATGGAGCTGTTTAGTTCATCATTCTTTCCTGCTGTTCTAAAAGTTCTTGAATCAAA
TATCCCACTTTTGGCTTCTATACCTATTCCAAAATTTGGCCGTGATATACCTGCAGTTGCAAGGTTGAGGGATCATCCAGGGGCTAAAATCTTCACTTTA
AGCCCGAGTAACAGTGATGCCGTCAAAGAACAAATTTACACCCAACTTGTAGATTCTGAGTAA
AA sequence
>Potri.005G101501.1 pacid=42803267 polypeptide=Potri.005G101501.1.p locus=Potri.005G101501 ID=Potri.005G101501.1.v4.1 annot-version=v4.1
MTPTMFRACACPSAWGCDPLETDRKIKIKMMATAPGKCFLVTGPPGVGKTTLIMRVFETLKTSNPTLKIQGFYTREIREGIERVGFEVVTLDGRKAPLAS
TTISTPESIRWPTVGKYKVDIASFEALALPELQIKEDTDLFIIDEVGKMELFSSSFFPAVLKVLESNIPLLASIPIPKFGRDIPAVARLRDHPGAKIFTL
SPSNSDAVKEQIYTQLVDSE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G66005 Expressed protein (.1.2.3) Potri.005G101501 0 1
AT2G26975 Ctr copper transporter family ... Potri.009G038700 16.12 0.7877 Pt-COPT2.1
Potri.005G127650 24.37 0.6689
AT3G09032 unknown protein Potri.006G097700 54.19 0.7282
AT1G11800 endonuclease/exonuclease/phosp... Potri.004G010400 68.58 0.7318
AT5G64460 Phosphoglycerate mutase family... Potri.001G286000 75.89 0.7250
AT1G60500 DRP4C Dynamin related protein 4C (.1... Potri.003G024600 92.22 0.7269
AT1G60500 DRP4C Dynamin related protein 4C (.1... Potri.003G024200 92.66 0.7195
AT5G45480 Protein of unknown function (D... Potri.006G013300 136.29 0.7118
AT2G24610 ATCNGC14 cyclic nucleotide-gated channe... Potri.006G271480 136.49 0.6955

Potri.005G101501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.