Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51380 86 / 1e-22 IQD20 IQ-domain 20 (.1) AT3G49260 66 / 2e-13 IQD21 IQ-domain 21 (.1.2.3) AT4G00820 66 / 3e-13 IQD17 IQ-domain 17 (.1) AT1G01110 60 / 3e-11 IQD18 IQ-domain 18 (.1.2) AT1G72670 58 / 1e-10 IQD8 IQ-domain 8 (.1) AT4G14750 57 / 3e-10 IQD19 IQ-domain 19 (.1) AT1G17480 55 / 1e-09 IQD7 IQ-domain 7 (.1) AT2G26180 52 / 2e-08 IQD6 IQ-domain 6 (.1) AT4G10640 50 / 5e-08 IQD16 IQ-domain 16 (.1) AT3G52290 50 / 6e-08 IQD3 IQ-domain 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G226600 [exp] 63 / 2e-12 AT2G26180 386 / 1e-131 IQ-domain 6 (.1) Potri.018G062001 [exp] 61 / 7e-12 AT2G26180 260 / 2e-85 IQ-domain 6 (.1) Potri.001G448100 [exp] 60 / 3e-11 AT4G00820 288 / 2e-90 IQ-domain 17 (.1) Potri.003G042700 [exp] 58 / 1e-10 AT1G72670 223 / 3e-68 IQ-domain 8 (.1) Potri.008G156700 [exp] 58 / 2e-10 AT4G14750 307 / 6e-101 IQ-domain 19 (.1) Potri.014G104600 [exp] 56 / 4e-10 AT4G00820 432 / 2e-146 IQ-domain 17 (.1) Potri.002G178500 [exp] 56 / 9e-10 AT4G00820 458 / 1e-156 IQ-domain 17 (.1) Potri.015G005900 [exp] 55 / 2e-09 AT4G00820 277 / 1e-86 IQ-domain 17 (.1) Potri.011G153400 [exp] 54 / 3e-09 AT4G00820 331 / 3e-107 IQ-domain 17 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041844 [exp] 94 / 1e-25 AT3G51380 100 / 9e-29 IQ-domain 20 (.1) Lus10014870 [exp] 67 / 1e-13 AT2G26180 249 / 5e-74 IQ-domain 6 (.1) Lus10012608 [exp] 59 / 7e-11 AT1G01110 432 / 8e-147 IQ-domain 18 (.1.2) Lus10010104 [exp] 57 / 2e-10 AT1G01110 434 / 3e-147 IQ-domain 18 (.1.2) Lus10021904 [exp] 56 / 9e-10 AT4G14750 314 / 2e-103 IQ-domain 19 (.1) Lus10008269 [exp] 51 / 3e-08 AT1G01110 317 / 8e-102 IQ-domain 18 (.1.2) Lus10006613 [exp] 51 / 5e-08 AT4G14750 295 / 6e-96 IQ-domain 19 (.1) Lus10005760 [exp] 50 / 5e-08 AT5G07240 219 / 3e-67 IQ-domain 24 (.1) Lus10013522 [exp] 49 / 1e-07 AT2G26180 403 / 2e-138 IQ-domain 6 (.1) Lus10027435 [exp] 49 / 3e-07 AT5G62070 207 / 3e-62 IQ-domain 23 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF00612 [poplar] [flax] IQ IQ calmodulin-binding motif
Representative CDS sequence Show only first row Show all	>Potri.005G106300.1 pacid=42805155 polypeptide=Potri.005G106300.1.p locus=Potri.005G106300 ID=Potri.005G106300.1.v4.1 annot-version=v4.1 ATGGCAAGAAAGAGGGTGTCTCGGAACTGGTTCGACAAAGTTCGGAGAAAGTTTCTCCGTTCATCTCATAGAAACATCATTCTCAATTCCAAAGCTTGCT CAAGTCACAGTGACGAGATCACAGAAGCAGGCGACTATGAGGTCTTCAATAGCATAGCTTCACCACCTTCGAAGAGAGAACTCGCCATAGAAGATATAGC AGCAATCACAATTCAAGCAAATTTCAGGGGACACCTTGCGAGGCGGGCATTTCGAGCACTCAGGAGCCTGGTGAAATTGCAAGCGTTGGCTCGAGGGGTG CATGTAAGGAAGCAATCACGCATAGCCCTTCAGTGCATGCACGCGCTCGTCCAGTTGCAGGTCCGTATTCGTGCGAGGCAGCTCCTCGGCCAGTGCAATG ATAACTGA
AA sequence Show only first row Show all	>Potri.005G106300.1 pacid=42805155 polypeptide=Potri.005G106300.1.p locus=Potri.005G106300 ID=Potri.005G106300.1.v4.1 annot-version=v4.1 MARKRVSRNWFDKVRRKFLRSSHRNIILNSKACSSHSDEITEAGDYEVFNSIASPPSKRELAIEDIAAITIQANFRGHLARRAFRALRSLVKLQALARGV HVRKQSRIALQCMHALVQLQVRIRARQLLGQCNDN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G51380		IQD20	IQ-domain 20 (.1)		Potri.005G106300 [exp]	0	1
AT4G25780			CAP (Cysteine-rich secretory p...		Potri.018G096028 [exp]	34.05	0.5812
					Potri.004G061100 [exp]	38.66	0.5959
					Potri.014G094600 [exp]	44.73	0.5628
AT1G62290			Saposin-like aspartyl protease...		Potri.010G003400 [exp]	72.56	0.5547	SOYAP2.1
AT3G27090			DCD (Development and Cell Deat...		Potri.001G330300 [exp]	78.51	0.5776
AT4G24660	ZF_HD	ATHB22, MEE68, ...	ZINC FINGER HOMEODOMAIN 2, MAT...		Potri.013G108900 [exp]	101.64	0.5479
AT4G31290			ChaC-like family protein (.1)		Potri.018G002900 [exp]	119.58	0.5341
AT5G53588		CPuORF50	conserved peptide upstream ope...		Potri.012G023450 [exp]	165.40	0.4754

Compare expression of checked genes

Potri.005G106300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.