Potri.005G106600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G107066 143 / 4e-46 AT1G16820 52 / 3e-10 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Potri.005G106933 130 / 4e-41 AT1G16820 52 / 2e-10 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Potri.005G106800 124 / 7e-39 AT3G57770 56 / 8e-11 Protein kinase superfamily protein (.1)
Potri.004G202466 105 / 6e-31 AT1G16820 53 / 3e-10 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Potri.007G002300 62 / 2e-14 ND /
Potri.008G047850 56 / 5e-12 AT3G57770 59 / 5e-12 Protein kinase superfamily protein (.1)
Potri.003G175366 56 / 7e-12 AT1G16820 57 / 2e-12 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.005G106600.2 pacid=42804301 polypeptide=Potri.005G106600.2.p locus=Potri.005G106600 ID=Potri.005G106600.2.v4.1 annot-version=v4.1
ATGAAAAAAAGCTTGAATGGAGCACACTACAAAAGAAAGCTTACTAGCTCTGAATCAATCATACCTTTCTCGGCCTTTTGGCTAAGATCAAGTGTAGTAT
CTGTTCTTATCAGTTTAATATCTGATACGTGGGCCAATGGCTCACACGATATTAAATTTATTTTTTTAGGGGGAGGGTCCATCACAGTAGCTTGCTACTG
GGGCTTTCGAGAGTCGCCTTTGCGCTGCACTATAGCATTGGCTTGGCGCTCCCCACCAACTCTAGTCTGA
AA sequence
>Potri.005G106600.2 pacid=42804301 polypeptide=Potri.005G106600.2.p locus=Potri.005G106600 ID=Potri.005G106600.2.v4.1 annot-version=v4.1
MKKSLNGAHYKRKLTSSESIIPFSAFWLRSSVVSVLISLISDTWANGSHDIKFIFLGGGSITVACYWGFRESPLRCTIALAWRSPPTLV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G57770 Protein kinase superfamily pro... Potri.005G106600 0 1
Potri.006G031300 2.82 0.9962
AT1G68840 AP2_ERF EDF2, RAV2, RAP... TEMPRANILLO 2, RELATED TO AP2 ... Potri.014G068000 5.00 0.9310
AT1G51400 Photosystem II 5 kD protein (.... Potri.009G052500 5.47 0.9235
AT1G74000 SS3 strictosidine synthase 3 (.1) Potri.015G037700 5.91 0.8747
AT1G01710 Acyl-CoA thioesterase family p... Potri.002G159150 6.70 0.8412
Potri.001G013101 8.12 0.7694
Potri.002G118950 10.24 0.7423
Potri.012G002350 14.07 0.6735
AT2G45280 ATRAD51C RAS associated with diabetes p... Potri.014G068100 18.49 0.6853 Pt-RAD51.1
AT1G01490 Heavy metal transport/detoxifi... Potri.018G148900 20.39 0.6439

Potri.005G106600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.