Potri.005G107066 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G106600 143 / 4e-46 AT3G57770 56 / 9e-11 Protein kinase superfamily protein (.1)
Potri.005G106800 141 / 2e-45 AT3G57770 56 / 8e-11 Protein kinase superfamily protein (.1)
Potri.005G106933 138 / 5e-44 AT1G16820 52 / 2e-10 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Potri.004G202466 109 / 2e-32 AT1G16820 53 / 3e-10 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Potri.007G002300 64 / 4e-15 ND /
Potri.008G047850 60 / 2e-13 AT3G57770 59 / 5e-12 Protein kinase superfamily protein (.1)
Potri.003G175366 56 / 8e-12 AT1G16820 57 / 2e-12 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022366 36 / 0.0006 ND /
PFAM info
Representative CDS sequence
>Potri.005G107066.1 pacid=42804486 polypeptide=Potri.005G107066.1.p locus=Potri.005G107066 ID=Potri.005G107066.1.v4.1 annot-version=v4.1
ATGGGACTTGAAAGGGCACAAGCAGGAGCGCACTATAAAAGAAAGCTTAGTAGCTCTGAATCAATCATACCTTTCTCGGCCTTTTGGCTAAGATCAAGTG
TAGTATCTGTTCTTATCAGTTTAATATCTGATACGTGGGCCAATGGCTCACACGATATTAAATTTATTTTTTTAGGGGGAGGGTCCATCACAGTAGCTTG
CTACTGGGGCTCTCGAGCGTCGCCTTTGCGCTGCACTATAGCATTGGCCTGGCGCTCCCCACCAACTCTAGTACCCAAAGCTTTGATTTATAGTGTGTGA
AA sequence
>Potri.005G107066.1 pacid=42804486 polypeptide=Potri.005G107066.1.p locus=Potri.005G107066 ID=Potri.005G107066.1.v4.1 annot-version=v4.1
MGLERAQAGAHYKRKLSSSESIIPFSAFWLRSSVVSVLISLISDTWANGSHDIKFIFLGGGSITVACYWGSRASPLRCTIALAWRSPPTLVPKALIYSV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G16820 vacuolar ATP synthase catalyti... Potri.005G107066 0 1
Potri.011G144466 5.19 0.8885
Potri.013G035350 16.09 0.8366
AT2G24430 NAC ANAC039, ANAC03... Arabidopsis NAC domain contain... Potri.016G027900 19.36 0.7524
Potri.008G223900 24.00 0.8897
AT3G57770 Protein kinase superfamily pro... Potri.005G106800 30.72 0.8200
Potri.008G224192 31.55 0.8727
AT1G16820 vacuolar ATP synthase catalyti... Potri.003G175366 33.25 0.8597
ATMG00640 ATMG00640.1, OR... hydrogen ion transporting ATP ... Potri.007G062422 36.08 0.8348
Potri.008G224501 38.57 0.8547
Potri.003G079550 39.37 0.8160

Potri.005G107066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.