ZF1.1 (Potri.005G108200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol ZF1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35840 369 / 5e-131 RING/U-box superfamily protein (.1)
AT2G17730 367 / 5e-130 NIP2 NEP-interacting protein 2 (.1.2)
AT5G66070 353 / 8e-125 RING/U-box superfamily protein (.1.2)
AT1G74410 149 / 8e-45 RING/U-box superfamily protein (.1)
AT3G20395 124 / 1e-34 RING/U-box superfamily protein (.1)
AT2G17450 78 / 1e-17 RHA3A RING-H2 finger A3A (.1)
AT3G18773 76 / 2e-16 RING/U-box superfamily protein (.1)
AT1G49200 74 / 8e-16 RING/U-box superfamily protein (.1)
AT3G03550 75 / 2e-15 RING/U-box superfamily protein (.1)
AT5G05280 72 / 2e-15 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G061400 421 / 2e-151 AT2G17730 351 / 8e-124 NEP-interacting protein 2 (.1.2)
Potri.001G435800 171 / 8e-53 AT3G20395 153 / 4e-46 RING/U-box superfamily protein (.1)
Potri.005G244800 141 / 2e-41 AT4G35840 132 / 3e-38 RING/U-box superfamily protein (.1)
Potri.005G244900 82 / 2e-19 AT5G66070 79 / 1e-18 RING/U-box superfamily protein (.1.2)
Potri.013G073500 79 / 4e-17 AT3G03550 262 / 2e-85 RING/U-box superfamily protein (.1)
Potri.019G043900 76 / 2e-16 AT3G03550 223 / 3e-71 RING/U-box superfamily protein (.1)
Potri.019G130100 74 / 3e-16 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
Potri.010G010500 76 / 4e-16 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Potri.018G098000 74 / 4e-16 AT2G18670 87 / 6e-22 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028406 428 / 2e-154 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10041859 428 / 2e-154 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10021524 159 / 2e-48 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1)
Lus10001654 142 / 2e-41 AT1G74410 251 / 1e-84 RING/U-box superfamily protein (.1)
Lus10021628 136 / 2e-39 AT1G74410 250 / 5e-84 RING/U-box superfamily protein (.1)
Lus10040073 86 / 2e-20 AT3G20395 94 / 5e-24 RING/U-box superfamily protein (.1)
Lus10013618 78 / 9e-17 AT5G17600 220 / 1e-69 RING/U-box superfamily protein (.1)
Lus10003400 74 / 2e-16 AT5G53110 152 / 3e-45 RING/U-box superfamily protein (.1)
Lus10024405 74 / 6e-16 AT4G17905 95 / 9e-24 RING/U-box superfamily protein (.1)
Lus10019018 75 / 2e-15 AT5G53110 332 / 4e-112 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0500 Glycine-zipper PF13488 Gly-zipper_Omp Glycine zipper
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.005G108200.1 pacid=42802971 polypeptide=Potri.005G108200.1.p locus=Potri.005G108200 ID=Potri.005G108200.1.v4.1 annot-version=v4.1
ATGGAGGTTTATCCATACCCATCTCGTTTTTCCATGTCTTCATTGTGTTCTTTTGGGAATTTTGTTGATAAGGTTAAAGAAGTTTGTAACTTCGTTGTTT
CAGCTATTATTGGCAACATATTCTCTGCGATCTTCACCTTTTTCTTTGCATTAGTGGGCACTTTGTTAGGAGCCATGACTGGGGCATTGATAGGCCAAGA
AACTGAAAGTGGGTTTGTTCGAGGGGCTGCAGTTGGAGCCATATCAGGGGCTGTTTTCTCAATTGAAGTATTCGAGTCATCTCTTGTTCTTTGGCAATCA
GATGAATCTGGGATAGGCTGTGTCCTTTACTTGATTGATGTTATCGCAAGCCTTCTTAGTGGACGACTTGTTCGTGAGCGCATTGGTCCTGCTATGTTAA
GTGCAGTACAAAGTCAGATGGGTGCTGTGGAAACAAATTTTGAGGAGATCCCAAACATCTTTGACACTGGTGGTTCCAAGGGATTACCTGGAGATTCTCT
TGAGAAGATCCCGAAGATCAGAATCACAAGCAATAACAATGTAGATGAATCAGGAGAGAAAGTCTCTTGTTCAGTTTGCCTTCAGGACTTTCAGCTGGGA
GAGACGGTTAGAAGCTTGCCTCATTGTCATCACATGTTTCACCTACCTTGCATAGATAAGTGGCTACTTAGGCATGCATCCTGCCCTCTGTGTAGAAGGG
ATCTGTGA
AA sequence
>Potri.005G108200.1 pacid=42802971 polypeptide=Potri.005G108200.1.p locus=Potri.005G108200 ID=Potri.005G108200.1.v4.1 annot-version=v4.1
MEVYPYPSRFSMSSLCSFGNFVDKVKEVCNFVVSAIIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQS
DESGIGCVLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVETNFEEIPNIFDTGGSKGLPGDSLEKIPKIRITSNNNVDESGEKVSCSVCLQDFQLG
ETVRSLPHCHHMFHLPCIDKWLLRHASCPLCRRDL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G35840 RING/U-box superfamily protein... Potri.005G108200 0 1 ZF1.1
AT4G27435 Protein of unknown function (D... Potri.001G403600 6.32 0.9213
AT4G29850 Eukaryotic protein of unknown ... Potri.018G133500 10.09 0.8992
AT5G54240 Protein of unknown function (D... Potri.011G126300 11.83 0.9026
AT2G33120 ATVAMP722, SAR1 ARABIDOPSIS THALIANA VESICLE-A... Potri.001G050400 16.12 0.8981
Potri.006G056101 17.34 0.8954
AT1G19940 ATGH9B5 glycosyl hydrolase 9B5 (.1) Potri.005G237700 21.16 0.8926
AT1G75280 NmrA-like negative transcripti... Potri.002G034400 25.88 0.8890
AT3G63095 Tetratricopeptide repeat (TPR)... Potri.014G139200 26.38 0.8149
AT3G18660 PGSIP1, GUX1 glucuronic acid substitution o... Potri.005G061600 26.66 0.8901
AT5G67210 IRX15-L IRX15-LIKE, Protein of unknown... Potri.007G047000 27.74 0.8886

Potri.005G108200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.