Potri.005G108666 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35880 0 / 1 Eukaryotic aspartyl protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G063800 0 / 1 AT4G35880 696 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041864 44 / 9e-07 AT4G35880 646 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10028410 42 / 4e-06 AT4G35880 672 / 0.0 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence
>Potri.005G108666.1 pacid=42803109 polypeptide=Potri.005G108666.1.p locus=Potri.005G108666 ID=Potri.005G108666.1.v4.1 annot-version=v4.1
ATGGTCTCTTATGGCTCTGCTCAAACATCTACTTCTGGGATTTTGGTAGAGGATGTTCTGCACTTGGCAACGGAAGATGGTGCGCACGAGAATTTGTTGA
AGACTACATCACATTTGGTTGTGGACAGGTTCAGATTGGTTCATTTCTGGACATTGCTGCTCCCATGGTCTATTTGGGCTGGGCATGGAGAAGATTTCTG
CTCCTAG
AA sequence
>Potri.005G108666.1 pacid=42803109 polypeptide=Potri.005G108666.1.p locus=Potri.005G108666 ID=Potri.005G108666.1.v4.1 annot-version=v4.1
MVSYGSAQTSTSGILVEDVLHLATEDGAHENLLKTTSHLVVDRFRLVHFWTLLLPWSIWAGHGEDFCS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G35880 Eukaryotic aspartyl protease f... Potri.005G108666 0 1
AT5G07670 RNI-like superfamily protein (... Potri.014G059100 5.56 0.8172
AT4G03500 Ankyrin repeat family protein ... Potri.019G108801 7.41 0.7736
Potri.004G088550 22.84 0.7147
Potri.006G001701 44.58 0.7071
AT5G14180 MPL1 Myzus persicae-induced lipase ... Potri.014G159800 45.09 0.7628
AT2G29940 ABCG31, PDR3, A... ATP-binding cassette G31, plei... Potri.009G045601 68.54 0.7503
AT5G18900 2-oxoglutarate (2OG) and Fe(II... Potri.010G027201 71.20 0.7385
AT2G16910 bHLH AMS, bHLH021 ABORTED MICROSPORES, basic hel... Potri.010G041500 82.99 0.6359
Potri.004G216601 86.34 0.6867
AT2G30740 Protein kinase superfamily pro... Potri.017G036501 87.77 0.7280

Potri.005G108666 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.