Plant FIBer expression Database

Potri.005G108850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.005G108850.1 pacid=42802364 polypeptide=Potri.005G108850.1.p locus=Potri.005G108850 ID=Potri.005G108850.1.v4.1 annot-version=v4.1
ATGACTTGGCTCTCAACTTGGATTTTCGCATGGAAACTGAAACCAGCACTCGGGACTCTTTATACTGGAACTGAGAGAGACTATAGACTGAGAGTTGTTG
TCAGAGGTGAAATGCTGGCCCAGAATCGTGAATCGGTGAAGGAGAAAGCTAATAATGGAGGAGTGCACTTTAAGCATCCTCACTGTAGTGTTACTAAAAG
ACAAACCTTGTCAATTCTGCCTTCACGCTCCTGGACCCTGGTCCCGTCCACAGTCCTCTCATCGGTATCAATAGCAATCGTAATTTATTCGAGTTCTGTA
TCTGCTGCTTAA
AA sequence
>Potri.005G108850.1 pacid=42802364 polypeptide=Potri.005G108850.1.p locus=Potri.005G108850 ID=Potri.005G108850.1.v4.1 annot-version=v4.1
MTWLSTWIFAWKLKPALGTLYTGTERDYRLRVVVRGEMLAQNRESVKEKANNGGVHFKHPHCSVTKRQTLSILPSRSWTLVPSTVLSSVSIAIVIYSSSV
SAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G108850
[exp]
0 1
AT3G44830 Lecithin:cholesterol acyltrans... Potri.009G150800
[exp]
11.22 0.8980
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Potri.009G157000
[exp]
16.91 0.9062
AT1G27170 transmembrane receptors;ATP bi... Potri.006G282100
[exp]
18.33 0.9188
AT4G14210 PDE226, PDS3 PIGMENT DEFECTIVE 226, phytoen... Potri.002G235200
[exp]
19.05 0.8993 PDS.2
AT2G25770 Polyketide cyclase/dehydrase a... Potri.018G046100
[exp]
22.58 0.9017
AT5G36930 Disease resistance protein (TI... Potri.011G008164
[exp]
24.49 0.9210
AT5G36930 Disease resistance protein (TI... Potri.011G008228
[exp]
25.03 0.9135
AT1G10930 ATSGS1, RECQL4A... DNA helicase (RECQl4A) (.1) Potri.003G015800
[exp]
25.39 0.8972
AT5G40840 SYN2, ATRAD21.1 Sister chromatid cohesion 1 \(... Potri.017G067400
[exp]
26.60 0.8890 SYN2.1
AT1G49180 protein kinase family protein ... Potri.019G011600
[exp]
28.14 0.8816

Potri.005G108850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.