Potri.005G108900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42180 442 / 3e-157 PER64 peroxidase 64, Peroxidase superfamily protein (.1)
AT5G51890 358 / 2e-124 Peroxidase superfamily protein (.1)
AT4G33420 284 / 5e-95 Peroxidase superfamily protein (.1)
AT1G05260 271 / 7e-90 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT5G64120 265 / 2e-87 Peroxidase superfamily protein (.1)
AT5G15180 264 / 5e-87 Peroxidase superfamily protein (.1)
AT4G36430 264 / 6e-87 Peroxidase superfamily protein (.1)
AT1G05250 263 / 6e-87 Peroxidase superfamily protein (.1)
AT1G05240 263 / 6e-87 Peroxidase superfamily protein (.1)
AT3G01190 263 / 9e-87 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G018000 491 / 8e-177 AT5G42180 483 / 1e-173 peroxidase 64, Peroxidase superfamily protein (.1)
Potri.007G122200 296 / 2e-99 AT5G15180 395 / 2e-138 Peroxidase superfamily protein (.1)
Potri.007G122351 295 / 3e-99 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122401 295 / 3e-99 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122250 295 / 3e-99 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122301 295 / 3e-99 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.018G136900 294 / 7e-99 AT4G33420 451 / 1e-160 Peroxidase superfamily protein (.1)
Potri.007G122451 291 / 2e-97 AT5G15180 374 / 3e-130 Peroxidase superfamily protein (.1)
Potri.T045500 290 / 2e-97 AT4G33420 441 / 9e-157 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005614 453 / 2e-161 AT5G42180 461 / 6e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10034547 451 / 7e-161 AT5G42180 471 / 7e-169 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10017288 451 / 1e-160 AT5G42180 462 / 4e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10031664 355 / 5e-123 AT5G51890 453 / 1e-161 Peroxidase superfamily protein (.1)
Lus10027405 353 / 7e-122 AT5G51890 448 / 2e-159 Peroxidase superfamily protein (.1)
Lus10029543 294 / 8e-99 AT4G33420 479 / 1e-171 Peroxidase superfamily protein (.1)
Lus10032926 275 / 2e-91 AT1G05260 292 / 5e-98 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10001324 274 / 7e-91 AT5G17820 327 / 6e-112 Peroxidase superfamily protein (.1)
Lus10013631 272 / 3e-90 AT5G17820 331 / 2e-113 Peroxidase superfamily protein (.1)
Lus10018374 271 / 7e-90 AT3G01190 414 / 4e-146 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.005G108900.1 pacid=42802701 polypeptide=Potri.005G108900.1.p locus=Potri.005G108900 ID=Potri.005G108900.1.v4.1 annot-version=v4.1
ATGGCTTTTGTTGCTGCTTTATGCTTGAGCTCGGTTCTCGTATTCTCGATATCTTCAGGAGCAGATGCACTGAGCTTGAATTACTATGAGAAAACATGCC
CTGATGTCGATTCCATTGTTACGAATGCTGTCAATCATGCAATGATGAAAGACAAAACGGTCCCCGCAGCGCTACTCCGGATGCATTTCCATGACTGTTT
CATAAGAGCCTGTGATGCTTCTGTTCTGCTAAATTCGAAAGGGAACAACAAAGCAGAGAAAGATGGCCCACCTAATATGTCTTTGCATGCGTTTTATGTC
ATTGACAACGCAAAGAAAGAAGTGGAAGCTTCATGCCCAGGAGTGGTATCATGCGCTGATATCTTGGCTTTAGCTGCAAGAGATGCAGTTGTACTTTCCG
GAGGTCCAACATGGGATGTCCCAAAAGGAAGAAAAGATGGGAGAACGTCAAGGGCTAGTGAAACAACACGGTTGCCTTCTCCTTCCTTTAACATAGCTCA
GCTGCAGCAGAGTTTCTCTCAGAGAGGTCTGTCCCTGGATGACCTTGTGGCTCTTTCAGGTGGCCATACTTTAGGGTTTTCCCACTGCTCATCCTTCCAA
AGTAGAATCCGCAATTTCAATGCCACTCATGACATAGACCCATCCATGCATCCATCGTTTGCAGCCAGCTTAAGGAGTATTTGTCCAAAATCGAACAGGG
CAAAGAATGCAGGAACAACCATGGATCCCTCGTCGACAACTTTTGATAATACATATTTCAAGTCGATCCTCCAGAAAAGGGGTCTATTCTCCTCAGACCA
ATCTCTACTCAGCACTCCAAAGACTAAAGATTTGGTCACCAAGTTTGCTAGCTCCAAAGCCAATTTCAATAAGGCTTTTGTATCATCCATGATCAAGATG
AGTAGCATCACAGGCGGTCAGGAGGTTAGGAAGGATTGTAGGGTGGTAAACTAA
AA sequence
>Potri.005G108900.1 pacid=42802701 polypeptide=Potri.005G108900.1.p locus=Potri.005G108900 ID=Potri.005G108900.1.v4.1 annot-version=v4.1
MAFVAALCLSSVLVFSISSGADALSLNYYEKTCPDVDSIVTNAVNHAMMKDKTVPAALLRMHFHDCFIRACDASVLLNSKGNNKAEKDGPPNMSLHAFYV
IDNAKKEVEASCPGVVSCADILALAARDAVVLSGGPTWDVPKGRKDGRTSRASETTRLPSPSFNIAQLQQSFSQRGLSLDDLVALSGGHTLGFSHCSSFQ
SRIRNFNATHDIDPSMHPSFAASLRSICPKSNRAKNAGTTMDPSSTTFDNTYFKSILQKRGLFSSDQSLLSTPKTKDLVTKFASSKANFNKAFVSSMIKM
SSITGGQEVRKDCRVVN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G42180 PER64 peroxidase 64, Peroxidase supe... Potri.005G108900 0 1
AT4G39070 CO B-box zinc finger family prote... Potri.009G122000 2.00 0.8369
AT2G45190 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, AB... Potri.001G120200 3.87 0.8020
AT1G70210 ATCYCD1;1, CYCD... CYCLIN D1;1 (.1) Potri.007G005700 4.58 0.7760
AT1G12700 RPF1 RNA processing factor 1, ATP b... Potri.018G038300 4.89 0.7600
AT4G30420 nodulin MtN21 /EamA-like trans... Potri.006G177700 6.63 0.8052
AT4G21760 BGLU47 beta-glucosidase 47 (.1) Potri.001G403900 7.21 0.7595
AT5G14450 GDSL-like Lipase/Acylhydrolase... Potri.001G342600 8.30 0.7391
AT1G55790 Domain of unknown function (DU... Potri.011G141700 9.74 0.7922
AT1G55790 Domain of unknown function (DU... Potri.001G438100 9.79 0.7948
AT5G67480 ATBT4, BT4 BTB and TAZ domain protein 4 (... Potri.007G055100 10.19 0.7056

Potri.005G108900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.