Potri.005G109600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51325 62 / 3e-13 RING/U-box superfamily protein (.1)
AT1G15100 57 / 7e-11 RHA2A RING-H2 finger A2A (.1)
AT3G30460 52 / 4e-09 RING/U-box superfamily protein (.1)
AT2G01150 52 / 4e-09 RHA2B RING-H2 finger protein 2B (.1)
AT4G32600 50 / 9e-08 RING/U-box superfamily protein (.1)
AT1G80400 50 / 1e-07 RING/U-box superfamily protein (.1)
AT1G72310 50 / 1e-07 ATL3 RING/U-box superfamily protein (.1)
AT5G45290 49 / 2e-07 RING/U-box superfamily protein (.1.2)
AT1G26800 48 / 2e-07 RING/U-box superfamily protein (.1)
AT2G04240 48 / 2e-07 XERICO RING/U-box superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G047100 56 / 2e-10 AT1G67856 133 / 4e-41 RING/U-box superfamily protein (.1)
Potri.008G125700 54 / 1e-09 AT2G01150 125 / 5e-37 RING-H2 finger protein 2B (.1)
Potri.008G185800 53 / 2e-09 AT1G67856 127 / 2e-38 RING/U-box superfamily protein (.1)
Potri.005G081200 52 / 8e-09 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1)
Potri.010G118000 50 / 5e-08 AT1G15100 142 / 7e-44 RING-H2 finger A2A (.1)
Potri.006G247000 49 / 2e-07 AT4G32600 498 / 1e-175 RING/U-box superfamily protein (.1)
Potri.014G170400 47 / 2e-07 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
Potri.018G034400 49 / 3e-07 AT4G32600 464 / 7e-162 RING/U-box superfamily protein (.1)
Potri.010G010500 48 / 4e-07 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018292 95 / 1e-25 AT3G51325 74 / 3e-18 RING/U-box superfamily protein (.1)
Lus10040617 88 / 5e-23 AT3G51325 69 / 3e-16 RING/U-box superfamily protein (.1)
Lus10013144 50 / 6e-08 AT4G32600 477 / 2e-167 RING/U-box superfamily protein (.1)
Lus10008106 50 / 1e-07 AT4G32600 410 / 1e-141 RING/U-box superfamily protein (.1)
Lus10022567 49 / 2e-07 AT5G55970 418 / 1e-146 RING/U-box superfamily protein (.1.2)
Lus10002706 48 / 4e-07 AT3G55530 382 / 5e-135 SALT- AND DROUGHT-INDUCED RING FINGER1, RING/U-box superfamily protein (.1)
Lus10000513 48 / 4e-07 AT3G55530 389 / 7e-138 SALT- AND DROUGHT-INDUCED RING FINGER1, RING/U-box superfamily protein (.1)
Lus10001568 48 / 5e-07 AT3G55530 361 / 9e-127 SALT- AND DROUGHT-INDUCED RING FINGER1, RING/U-box superfamily protein (.1)
Lus10023235 47 / 7e-07 AT5G08139 194 / 7e-58 RING/U-box superfamily protein (.1)
Lus10004977 47 / 8e-07 AT3G55530 371 / 1e-130 SALT- AND DROUGHT-INDUCED RING FINGER1, RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.005G109600.1 pacid=42803116 polypeptide=Potri.005G109600.1.p locus=Potri.005G109600 ID=Potri.005G109600.1.v4.1 annot-version=v4.1
ATGGTTCTCAAAAAATTCGTCTCCTTCGTGTACAGCTTCATAGGCCTCAGATGGCATCCGAGGATTAAAGATGCGGCGGCAGCTGCAGCTTGTAGGAGAA
TCACAGTGGATGTGTCGGGCAACGTCAAGCAAGGCGTGCTCGAATCTCCTGTCGGATCAAGTTCATCCGAAATCATAGAAGCTGAAGGTGAATACTGTTG
TGTTTGCTTGTCGCGATTGAAGGCAGATGAGGACACGAGTGCTTTACCATGCTTGCACAGGTTTCATAAGGTATGCATAGAAGGATGGTTTAATAATGTG
TGTCGAAGAACTTGTCCGCTGTGCCGGTCGTCCATGGGGGGAGAAGAGAGGTCTCATAAGAGAGAAGAACAGTTCACTGAAGAGATGGTAATATGGTTTT
CTTCTTTTCATGTAGCTGGTTTTTGA
AA sequence
>Potri.005G109600.1 pacid=42803116 polypeptide=Potri.005G109600.1.p locus=Potri.005G109600 ID=Potri.005G109600.1.v4.1 annot-version=v4.1
MVLKKFVSFVYSFIGLRWHPRIKDAAAAAACRRITVDVSGNVKQGVLESPVGSSSSEIIEAEGEYCCVCLSRLKADEDTSALPCLHRFHKVCIEGWFNNV
CRRTCPLCRSSMGGEERSHKREEQFTEEMVIWFSSFHVAGF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G51325 RING/U-box superfamily protein... Potri.005G109600 0 1
AT2G37090 IRX9 IRREGULAR XYLEM 9, Nucleotide-... Potri.006G131000 3.00 0.9508
AT2G37585 Core-2/I-branching beta-1,6-N-... Potri.006G263000 4.89 0.9259
AT5G16590 LRR1 Leucine rich repeat protein 1,... Potri.004G086100 5.29 0.9230
AT1G09610 Protein of unknown function (D... Potri.004G226800 8.12 0.9277
AT2G34410 RWA3 REDUCED WALL ACETYLATION 3, O-... Potri.011G079400 8.60 0.9409
Potri.011G057400 11.83 0.9166
AT1G09610 Protein of unknown function (D... Potri.003G003801 13.26 0.9142
Potri.004G048201 15.65 0.8851
AT5G67230 IRX14-L, I14H IRREGULAR XYLEM 14-LIKE, IRREG... Potri.007G047500 15.87 0.9233
AT1G26480 GF14IOTA, GRF12 general regulatory factor 12 (... Potri.008G095000 17.49 0.9090 Pt-GRF12.2

Potri.005G109600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.