Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1) AT4G36040 133 / 1e-40 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) AT3G13310 95 / 2e-25 Chaperone DnaJ-domain superfamily protein (.1) AT4G13830 71 / 2e-16 J20 DNAJ-like 20 (.1.2) AT4G39960 67 / 1e-13 Molecular chaperone Hsp40/DnaJ family protein (.1) AT1G80030 66 / 3e-13 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3) AT1G24120 65 / 6e-13 ARL1 ARG1-like 1 (.1) AT1G59980 65 / 6e-13 GPS4, ARL2 ,ATDJC39 gravity persistence signal 4, ARG1-like 2 (.1) AT2G22360 64 / 1e-12 DNAJ heat shock family protein (.1) AT4G28480 63 / 1e-12 DNAJ heat shock family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G020800 [exp] 127 / 3e-38 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.004G172300 [exp] 126 / 5e-38 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G240700 [exp] 124 / 6e-37 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1) Potri.009G131800 [exp] 117 / 6e-35 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G020700 [exp] 112 / 2e-32 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1) Potri.001G469600 [exp] 95 / 2e-25 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1) Potri.011G166500 [exp] 91 / 6e-24 AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.006G001301 [exp] 88 / 5e-23 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1) Potri.007G107600 [exp] 85 / 9e-22 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028453 [exp] 154 / 5e-49 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1) Lus10041906 [exp] 152 / 5e-48 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10017263 [exp] 110 / 2e-31 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10034484 [exp] 100 / 7e-28 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10025060 [exp] 89 / 6e-24 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10032957 [exp] 89 / 3e-23 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1) Lus10013558 [exp] 82 / 2e-21 AT4G36040 82 / 1e-21 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10002356 [exp] 72 / 2e-16 AT4G13830 144 / 1e-43 DNAJ-like 20 (.1.2) Lus10003150 [exp] 72 / 5e-16 AT4G13830 151 / 3e-46 DNAJ-like 20 (.1.2) Lus10002355 [exp] 69 / 4e-15 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [poplar] [flax] Chaperone-J PF00226 [poplar] [flax] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Potri.005G113100.5 pacid=42803136 polypeptide=Potri.005G113100.5.p locus=Potri.005G113100 ID=Potri.005G113100.5.v4.1 annot-version=v4.1 ATGCTCTCTCCCTGCCTCTCCACTTCTGCTCCTCCACGTGTAACATTCAAGCGACCGTTAGTAACGAACAGCACCACCACCACTCTCCCGCCGCGAAATC TGTCTCTGAAGAAACCTCAAGGCATGGCCTCATCTTTGTACGAGATTCTAAGGATTCCGGTGGGGGCAACAAACCAGGAGATCAAGACTGCTTACCGGAG ACTGGCCAGGACTTACCACCCTGACGTGGTTGCCGAGGACCGGAAAGACACGTCTGCTGACGAGTTTATGAAGTTACACGCTGCCTATTCAACTCTATCA GACCCGGAAAAGCGGGCTGTTTATGATAGTAAGCTATTTATAAGGAAGCAGCGGCCATTGACCACCGTGGGGTTTTCGGGCTATAGTGGCCGGACATGGG AAACTGATCAGTGTTGGTAG
AA sequence Show only first row Show all	>Potri.005G113100.5 pacid=42803136 polypeptide=Potri.005G113100.5.p locus=Potri.005G113100 ID=Potri.005G113100.5.v4.1 annot-version=v4.1 MLSPCLSTSAPPRVTFKRPLVTNSTTTTLPPRNLSLKKPQGMASSLYEILRIPVGATNQEIKTAYRRLARTYHPDVVAEDRKDTSADEFMKLHAAYSTLS DPEKRAVYDSKLFIRKQRPLTTVGFSGYSGRTWETDQCW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G17880			Chaperone DnaJ-domain superfam...		Potri.005G113100 [exp]	0	1
AT3G18560			unknown protein		Potri.017G128700 [exp]	4.24	0.8826
AT5G36930			Disease resistance protein (TI...		Potri.013G098100 [exp]	8.24	0.8925
AT1G77210		AtSTP14	sugar transport protein 14, su...		Potri.018G085200 [exp]	9.53	0.8460	RCSTG.1
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Potri.001G471200 [exp]	10.95	0.8760	UBC.6
AT5G16370		AAE5	acyl activating enzyme 5 (.1)		Potri.019G067800 [exp]	14.69	0.8885
					Potri.011G051000 [exp]	15.58	0.8530
AT4G38460		GGR	geranylgeranyl reductase (.1)		Potri.009G139600 [exp]	20.29	0.8789
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Potri.017G048700 [exp]	32.40	0.8200
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.013G076600 [exp]	32.72	0.8429	Pt-CYP89.2
AT2G28930		APK1B	protein kinase 1B (.1.2.3)		Potri.010G203400 [exp]	36.74	0.8292

Compare expression of checked genes

Potri.005G113100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.