Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17450 66 / 2e-13 RHA3A RING-H2 finger A3A (.1) AT5G01880 66 / 2e-13 RING/U-box superfamily protein (.1) AT5G66160 67 / 3e-13 JR700, ATRMR1 ARABIDOPSIS THALIANA RECEPTOR HOMOLOGY REGION TRANSMEMBRANE DOMAIN RING H2 MOTIF PROTEIN 1, receptor homology region transmembrane domain ring H2 motif protein 1 (.1.2) AT2G17730 66 / 6e-13 NIP2 NEP-interacting protein 2 (.1.2) AT3G10910 64 / 8e-13 RING/U-box superfamily protein (.1) AT5G47610 64 / 8e-13 RING/U-box superfamily protein (.1) AT4G35840 65 / 1e-12 RING/U-box superfamily protein (.1) AT5G05280 64 / 1e-12 RING/U-box superfamily protein (.1) AT5G66070 64 / 2e-12 RING/U-box superfamily protein (.1.2) AT4G35480 63 / 3e-12 RHA3B RING-H2 finger A3B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G057300 [exp] 153 / 3e-47 AT2G17450 66 / 1e-13 RING-H2 finger A3A (.1) Potri.019G130100 [exp] 69 / 3e-14 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1) Potri.003G075200 [exp] 67 / 9e-14 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1) Potri.001G159300 [exp] 65 / 3e-13 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1) Potri.001G309600 [exp] 66 / 4e-13 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1) Potri.014G076800 [exp] 65 / 7e-13 AT4G10150 84 / 1e-19 RING/U-box superfamily protein (.1) Potri.019G010500 [exp] 65 / 8e-13 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1) Potri.007G086100 [exp] 64 / 8e-13 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1) Potri.013G091300 [exp] 64 / 9e-13 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028454 [exp] 78 / 8e-18 AT1G72200 85 / 3e-19 RING/U-box superfamily protein (.1) Lus10041907 [exp] 80 / 3e-17 AT4G36050 410 / 6e-135 endonuclease/exonuclease/phosphatase family protein (.1.2) Lus10033425 [exp] 69 / 1e-14 AT3G10910 82 / 6e-20 RING/U-box superfamily protein (.1) Lus10020859 [exp] 67 / 3e-13 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1) Lus10033515 [exp] 66 / 6e-13 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1) Lus10006785 [exp] 66 / 6e-13 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1) Lus10021524 [exp] 65 / 1e-12 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1) Lus10013210 [exp] 65 / 1e-12 AT1G20823 207 / 3e-68 RING/U-box superfamily protein (.1) Lus10006787 [exp] 64 / 2e-12 AT1G49230 159 / 9e-49 RING/U-box superfamily protein (.1) Lus10005816 [exp] 64 / 2e-12 AT1G49230 169 / 5e-53 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.005G113200.1 pacid=42804332 polypeptide=Potri.005G113200.1.p locus=Potri.005G113200 ID=Potri.005G113200.1.v4.1 annot-version=v4.1 ATGGATCAGATTCATCATTTTAGTAGACAGATGTTGAACGGTAATTTGCCAAGACAAGAGGAACAAGCAGACCAAGGAGGATCAATTGCAGGTATTGGCA TTGCATCTGTTATGATATTAATTCTTGTCGTTCTCATTTCTGTTTCCATCTGCAAGTGTTCTATCAGCTTAATCAACTTTCCTTCTAATAATCAACAAAA TCCAACAACATCCAACTCATGTTCCAGTGAATCTGATACACAAACCCACCATGAACTTGTAGCCCTCCCAGTTTTTGTCTTTGGAGAGCAAACACCACCC TCAGCCCCAACGTTGCCACAATCATCATCATCATCTTCTTCTTCTCCTTTCGCGTTTTCTGATAAAAGCTGTGCAATTTGCTTGGATGATTATGCTTATG GAGAGTTCATAAGGGTCTTGCCTAGGTGTAAGCACATGTTCCATAAGGACTGCATCGATAACTGGCTATCATCAAGAACTTCAAGTTGTCCCATTTGTAG AGACCAAATCATAGACAAGAATGTGGAGTCTACAAGGATAGATTCTCCTAATATGGTGGAAAATGTAACCGGATCATTTACGTTGTTTCCTGTCAGCAAT AGCACGATACCCAACTGA
AA sequence Show only first row Show all	>Potri.005G113200.1 pacid=42804332 polypeptide=Potri.005G113200.1.p locus=Potri.005G113200 ID=Potri.005G113200.1.v4.1 annot-version=v4.1 MDQIHHFSRQMLNGNLPRQEEQADQGGSIAGIGIASVMILILVVLISVSICKCSISLINFPSNNQQNPTTSNSCSSESDTQTHHELVALPVFVFGEQTPP SAPTLPQSSSSSSSSPFAFSDKSCAICLDDYAYGEFIRVLPRCKHMFHKDCIDNWLSSRTSSCPICRDQIIDKNVESTRIDSPNMVENVTGSFTLFPVSN STIPN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G17450		RHA3A	RING-H2 finger A3A (.1)		Potri.005G113200 [exp]	0	1
					Potri.017G035600 [exp]	11.53	0.9186
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Potri.004G012700 [exp]	25.49	0.9103
AT2G16050			Cysteine/Histidine-rich C1 dom...		Potri.010G205200 [exp]	26.64	0.9267
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Potri.004G012601 [exp]	32.17	0.9081
AT5G47990		THAD1, THAD, CY...	THALIAN-DIOL DESATURASE, "cyto...		Potri.009G065000 [exp]	43.41	0.9217	CYP705B5
AT1G78310			VQ motif-containing protein (....		Potri.005G162300 [exp]	48.85	0.8929
AT1G78780			pathogenesis-related family pr...		Potri.005G188400 [exp]	51.96	0.9242	Pt-PR.3
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Potri.001G270700 [exp]	53.75	0.8829
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Potri.019G003800 [exp]	61.13	0.9119
AT3G56710		SIB1	sigma factor binding protein 1...		Potri.003G194700 [exp]	87.20	0.9106

Compare expression of checked genes

Potri.005G113200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.