Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	HIS1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18050 117 / 3e-33 HIS1-3 histone H1-3 (.1.2) AT2G30620 77 / 1e-17 winged-helix DNA-binding transcription factor family protein (.1.2) AT1G06760 67 / 2e-13 winged-helix DNA-binding transcription factor family protein (.1) AT1G14900 48 / 6e-07 HMGA high mobility group A (.1) AT3G18035 49 / 9e-07 HON4 winged-helix DNA-binding transcription factor family protein (.1) AT1G72740 47 / 2e-06 MYB Homeodomain-like/winged-helix DNA-binding family protein (.1.2) AT1G54260 47 / 2e-06 winged-helix DNA-binding transcription factor family protein (.1) AT1G49950 45 / 1e-05 MYB ATTRB1, TRB1 telomere repeat binding factor 1 (.1.2.3) AT1G48620 45 / 1e-05 HON5 high mobility group A5 (.1) AT5G67580 42 / 0.0002 MYB ATTBP3, TRB2, ATTRB2 TELOMERE-BINDING PROTEIN 3, TELOMERE REPEAT BINDING FACTOR 2, Homeodomain-like/winged-helix DNA-binding family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G014200 [exp] 137 / 5e-41 AT2G18050 109 / 2e-30 histone H1-3 (.1.2) Potri.008G162300 [exp] 75 / 7e-17 AT2G30620 76 / 2e-17 winged-helix DNA-binding transcription factor family protein (.1.2) Potri.002G199900 [exp] 74 / 2e-16 AT2G30620 84 / 4e-20 winged-helix DNA-binding transcription factor family protein (.1.2) Potri.005G219800 [exp] 74 / 8e-16 AT1G06760 89 / 1e-20 winged-helix DNA-binding transcription factor family protein (.1) Potri.010G076800 [exp] 71 / 2e-15 AT1G06760 77 / 4e-17 winged-helix DNA-binding transcription factor family protein (.1) Potri.013G042700 [exp] 71 / 5e-15 AT2G30620 66 / 2e-13 winged-helix DNA-binding transcription factor family protein (.1.2) Potri.002G043100 [exp] 69 / 7e-14 AT2G30620 92 / 3e-22 winged-helix DNA-binding transcription factor family protein (.1.2) Potri.009G087000 [exp] 53 / 2e-08 AT1G49950 277 / 5e-93 telomere repeat binding factor 1 (.1.2.3) Potri.001G292700 [exp] 53 / 3e-08 AT1G49950 273 / 2e-91 telomere repeat binding factor 1 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025968 [exp] 124 / 5e-35 AT2G18050 132 / 6e-39 histone H1-3 (.1.2) Lus10014267 [exp] 103 / 4e-28 AT2G18050 102 / 1e-28 histone H1-3 (.1.2) Lus10042541 [exp] 75 / 7e-16 AT2G30620 121 / 3e-33 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10022001 [exp] 74 / 8e-16 AT2G30620 115 / 3e-31 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10006562 [exp] 70 / 6e-15 AT2G30620 112 / 2e-31 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10005534 [exp] 69 / 3e-14 AT2G30620 116 / 9e-32 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10005535 [exp] 67 / 2e-13 AT2G30620 124 / 8e-35 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10006561 [exp] 62 / 2e-11 AT2G30620 115 / 1e-31 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10033775 [exp] 49 / 1e-06 AT5G15340 635 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014653 [exp] 49 / 1e-06 AT5G15340 634 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00538 [poplar] [flax] Linker_histone linker histone H1 and H5 family
Representative CDS sequence Show only first row Show all	>Potri.005G116600.1 pacid=42803719 polypeptide=Potri.005G116600.1.p locus=Potri.005G116600 ID=Potri.005G116600.1.v4.1 annot-version=v4.1 ATGACAACCAGCAAAGAAGCTGAAACTGAAGCTCCCGTGGTTGAGCAGCCCCCTGCTACAGAAGAGCCTAAGGTGGAGGAGAAGCCTTTGAAAGAAAAGA AGCCAAGGACTCCTAGAGAAAAGAAGCCTAGACAACCTAAACCAAAAGCTGTTGCTCATCCTCCTTATTTTCAGATGATCAAGGAGGCTATATTGGCTTT GAATGAGAAAAGTGGGTCCAGTCCATATGCAATAGCCAAGTACATGGAAGAGAAGCACAAAGCAGTACTCCCAGCAAATTTCAAGAAAATTCTAGGTCTT CAATTGAAGAACTCTGCAGCGAGAGGAAAGTTAATCAAGATCAGGGCATCTTACAAGCTGTCAGAGGCAGGAAAGAAGGAGAAGAGCACTACAGGGAAAG TCTCCAAGGGAAGTAGTGCAGTGAAGAAGACTAAAGAGGTTAAACCTAGTATGAGAAAGACCAGGTCTGTGAATAAAGCTGATGCTGGTGCAAAGAAAGT TGTTGGGGCGAAGAAGGCCAAGAAATCAGCTGCTGCTAAACCTAAACAGCCCAAGTCTATCAAATCTCCTGCTGCCAAAAGGGCAAAGAAAGTTACTGCT ACTGCTTAG
AA sequence Show only first row Show all	>Potri.005G116600.1 pacid=42803719 polypeptide=Potri.005G116600.1.p locus=Potri.005G116600 ID=Potri.005G116600.1.v4.1 annot-version=v4.1 MTTSKEAETEAPVVEQPPATEEPKVEEKPLKEKKPRTPREKKPRQPKPKAVAHPPYFQMIKEAILALNEKSGSSPYAIAKYMEEKHKAVLPANFKKILGL QLKNSAARGKLIKIRASYKLSEAGKKEKSTTGKVSKGSSAVKKTKEVKPSMRKTRSVNKADAGAKKVVGAKKAKKSAAAKPKQPKSIKSPAAKRAKKVTA TA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18050		HIS1-3	histone H1-3 (.1.2)		Potri.005G116600 [exp]	0	1	HIS1.2
AT5G11580			Regulator of chromosome conden...		Potri.018G044400 [exp]	5.19	0.8404
AT2G18050		HIS1-3	histone H1-3 (.1.2)		Potri.007G014200 [exp]	9.16	0.8048	HON905,HIS1.1
AT3G11210			SGNH hydrolase-type esterase s...		Potri.016G116100 [exp]	9.48	0.8050
AT1G68220			Protein of unknown function (D...		Potri.008G124100 [exp]	10.19	0.7914
					Potri.004G068901 [exp]	16.43	0.7663
AT1G10155		ATPP2-A10	phloem protein 2-A10 (.1)		Potri.015G120100 [exp]	27.16	0.7754
AT3G10210			SEC14 cytosolic factor family ...		Potri.006G043166 [exp]	27.65	0.7757
AT5G40940		FLA20	putative fasciclin-like arabin...		Potri.008G127500 [exp]	34.78	0.7741
AT2G15890		MEE14	maternal effect embryo arrest ...		Potri.009G108200 [exp]	35.07	0.7999
AT2G15695			Protein of unknown function DU...		Potri.009G103500 [exp]	39.94	0.7742

Compare expression of checked genes

Potri.005G116600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.