Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-UBC17.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75440 296 / 1e-104 UBC16 ubiquitin-conjugating enzyme 16 (.1) AT5G42990 290 / 2e-102 UBC18 ubiquitin-conjugating enzyme 18 (.1) AT1G45050 287 / 3e-101 ATUBC2-1, UBC15 Arabidopsis thaliana ubiquitin-conjugating enzyme 15, Ubiquitin-conjugating enzyme family protein (.1) AT4G36410 274 / 6e-96 UBC17 ubiquitin-conjugating enzyme 17 (.1) AT5G41700 86 / 9e-22 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT3G08690 85 / 2e-21 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT2G16740 85 / 2e-21 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G53300 84 / 4e-21 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT5G56150 84 / 5e-21 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT4G27960 83 / 7e-21 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G018700 [exp] 334 / 9e-120 AT1G75440 295 / 3e-104 ubiquitin-conjugating enzyme 16 (.1) Potri.002G030800 [exp] 311 / 2e-110 AT5G42990 251 / 9e-87 ubiquitin-conjugating enzyme 18 (.1) Potri.005G232100 [exp] 295 / 2e-104 AT5G42990 256 / 1e-88 ubiquitin-conjugating enzyme 18 (.1) Potri.001G094900 [exp] 88 / 1e-22 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.012G033000 [exp] 88 / 1e-22 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.015G023300 [exp] 88 / 1e-22 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.004G175000 [exp] 86 / 1e-21 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.016G138900 [exp] 85 / 2e-21 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.019G131400 [exp] 85 / 2e-21 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028341 [exp] 264 / 5e-92 AT1G75440 250 / 8e-87 ubiquitin-conjugating enzyme 16 (.1) Lus10041791 [exp] 262 / 7e-91 AT1G75440 246 / 9e-85 ubiquitin-conjugating enzyme 16 (.1) Lus10032352 [exp] 88 / 1e-22 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10033937 [exp] 88 / 1e-22 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10039323 [exp] 87 / 5e-22 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014942 [exp] 87 / 5e-22 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 87 / 5e-22 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 87 / 5e-22 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10009422 [exp] 86 / 1e-21 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10028700 [exp] 86 / 1e-21 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.005G118600.1 pacid=42804520 polypeptide=Potri.005G118600.1.p locus=Potri.005G118600 ID=Potri.005G118600.1.v4.1 annot-version=v4.1 ATGACGAGCTCCTCTACAACGACCCGCAAGGCACTGAGTAAGATTGCTTGCAATCGGCTTCAGAAAGAACTTGTTGAGTGGCAAGTCAATCCTCCAACTG GTTTTAAACATAAAGTCACTGATAATCTCCAAAGGTGGGTTATTGAAGTAATTGGAGCTCCGGGCACCCTTTATGCAAATGAGACCTATCAGCTTCAAGT TGATTTCCCTGAGCATTACCCGATGGAAGCTCCTCAGGTTATATTTCTTCATCCGGCTCCGCTTCATCCGCATATTTATAGCAATGGCCATATTTGTTTA GATATACTGTATGATTCTTGGTCACCTGCCATGACTGTTAGTTCTGTCTGCATCAGTATTCTCTCTATGCTTTCAAGCTCCACTGTGAAGCAACGTCCCG AGGATAATGACCGATATGTAAAGAACTGTAGAAATGGAAGATCTCCGAAGGAGACCAGGTGGTGGTTCCATGATGATAAAGTGTAA
AA sequence Show only first row Show all	>Potri.005G118600.1 pacid=42804520 polypeptide=Potri.005G118600.1.p locus=Potri.005G118600 ID=Potri.005G118600.1.v4.1 annot-version=v4.1 MTSSSTTTRKALSKIACNRLQKELVEWQVNPPTGFKHKVTDNLQRWVIEVIGAPGTLYANETYQLQVDFPEHYPMEAPQVIFLHPAPLHPHIYSNGHICL DILYDSWSPAMTVSSVCISILSMLSSSTVKQRPEDNDRYVKNCRNGRSPKETRWWFHDDKV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75440		UBC16	ubiquitin-conjugating enzyme 1...		Potri.005G118600 [exp]	0	1	Pt-UBC17.2
AT5G05800			unknown protein		Potri.004G135901 [exp]	2.82	0.7130
AT4G14410	bHLH	bHLH104	basic Helix-Loop-Helix 104, ba...		Potri.010G072900 [exp]	3.16	0.6724
AT3G12760			unknown protein		Potri.008G083800 [exp]	14.73	0.6009
AT5G59960			unknown protein		Potri.009G028500 [exp]	17.08	0.6767
AT2G15000			unknown protein		Potri.001G298800 [exp]	19.13	0.6591
AT5G25360			unknown protein		Potri.006G068600 [exp]	24.14	0.6445
AT4G15520			tRNA/rRNA methyltransferase (S...		Potri.008G198200 [exp]	30.00	0.5981
AT5G59460			scarecrow-like transcription f...		Potri.009G033400 [exp]	30.29	0.5447
AT3G48900			single-stranded DNA endonuclea...		Potri.015G142800 [exp]	30.39	0.6431
					Potri.002G120500 [exp]	39.42	0.6553

Compare expression of checked genes

Potri.005G118600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.