Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05220 64 / 1e-12 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G26690 57 / 2e-11 Heavy metal transport/detoxification superfamily protein (.1) AT5G19090 58 / 1e-10 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT3G06130 57 / 2e-10 Heavy metal transport/detoxification superfamily protein (.1.2) AT1G01490 53 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G56891 53 / 3e-09 Heavy metal transport/detoxification superfamily protein (.1) AT3G05920 52 / 3e-09 Heavy metal transport/detoxification superfamily protein (.1) AT5G37860 51 / 3e-08 Heavy metal transport/detoxification superfamily protein (.1) AT5G27690 50 / 5e-08 Heavy metal transport/detoxification superfamily protein (.1) AT5G52740 48 / 5e-08 Copper transport protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G021200 [exp] 152 / 1e-48 AT3G05220 65 / 6e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.018G148900 [exp] 71 / 1e-16 AT1G01490 66 / 1e-14 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.006G079400 [exp] 67 / 2e-15 AT5G37860 66 / 4e-14 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G032800 [exp] 66 / 1e-14 AT3G05920 52 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G230300 [exp] 66 / 1e-14 AT1G01490 57 / 3e-11 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.008G202800 [exp] 59 / 8e-11 AT3G06130 150 / 6e-41 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G132000 [exp] 58 / 1e-10 AT5G27690 114 / 4e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G073100 [exp] 54 / 5e-10 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.003G132200 [exp] 54 / 7e-10 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028331 [exp] 82 / 5e-20 AT1G06330 56 / 7e-10 Heavy metal transport/detoxification superfamily protein (.1) Lus10007911 [exp] 61 / 7e-12 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 60 / 3e-11 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10041228 [exp] 58 / 1e-10 AT3G06130 149 / 3e-41 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10036395 [exp] 56 / 3e-10 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 56 / 4e-10 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014967 [exp] 55 / 5e-10 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10041879 [exp] 53 / 2e-09 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10028426 [exp] 53 / 2e-09 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10019789 [exp] 51 / 8e-09 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.005G120200.1 pacid=42804605 polypeptide=Potri.005G120200.1.p locus=Potri.005G120200 ID=Potri.005G120200.1.v4.1 annot-version=v4.1 ATGGCACAAAGAACAGTCTTGAAGGTTGATATTTCATGCGAGAAATGCAAGAAAAAGCTTCTCAAAGCTGTGTCTACACTTGAAGGTGTAGATAAGATTG AGGCTGATCAAGCGAAGGGAACATTAACGGTAACAGGAAATGCAGACCCGTATGAGATAATAATGCGTACAAGAAAAACAGGGAAACATGCAGACGTAGT GAGCATAGGGCCACCTCCGGCACCACCAAAACAAGATGGGCAAAAGAAGCCACAAGAGAAGAAGCCGGAGAAGAAGCCGGAGGAGAAGGCCCAAATCCAT GATCCACACACTTGTCATCAGTGTCGGCAAATATATCTCATGCCAATGCCAATGTCAATGGCCCCATGTTATGAGCCCAACCCATCATGCTCCGTCATGT GA
AA sequence Show only first row Show all	>Potri.005G120200.1 pacid=42804605 polypeptide=Potri.005G120200.1.p locus=Potri.005G120200 ID=Potri.005G120200.1.v4.1 annot-version=v4.1 MAQRTVLKVDISCEKCKKKLLKAVSTLEGVDKIEADQAKGTLTVTGNADPYEIIMRTRKTGKHADVVSIGPPPAPPKQDGQKKPQEKKPEKKPEEKAQIH DPHTCHQCRQIYLMPMPMSMAPCYEPNPSCSVM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05220			Heavy metal transport/detoxifi...		Potri.005G120200 [exp]	0	1
AT2G45220			Plant invertase/pectin methyle...		Potri.015G127700 [exp]	1.00	0.9851	Pt-PME.5
AT5G06720		ATPA2	peroxidase 2 (.1)		Potri.016G058200 [exp]	2.00	0.9766	HPOX14.2
AT1G53130		GRI	GRIM REAPER, Stigma-specific S...		Potri.011G118600 [exp]	2.82	0.9683
AT3G10720			Plant invertase/pectin methyle...		Potri.008G011100 [exp]	3.87	0.9688
AT1G21326			VQ motif-containing protein (....		Potri.002G070600 [exp]	5.19	0.9318
AT5G66420			unknown protein		Potri.005G120100 [exp]	6.48	0.9630
AT4G35220			Cyclase family protein (.1)		Potri.001G301700 [exp]	7.48	0.9594
AT1G11330			S-locus lectin protein kinase ...		Potri.011G037800 [exp]	8.36	0.9414
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Potri.007G095000 [exp]	9.79	0.9325
AT3G54220	GRAS	SGR1, SCR	SHOOT GRAVITROPISM 1, SCARECRO...		Potri.005G226800 [exp]	10.48	0.9478

Compare expression of checked genes

Potri.005G120200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.