Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-SYP112.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18260 356 / 9e-124 ATSYP112, SYP112 syntaxin of plants 112 (.1) AT1G08560 206 / 6e-65 KN, ATSYP111, SYP111 KNOLLE, syntaxin of plants 111 (.1) AT1G61290 202 / 1e-63 ATSYP124, SYP124 syntaxin of plants 124 (.1) AT4G03330 187 / 2e-57 ATSYP123, SYP123 syntaxin of plants 123 (.1) AT3G11820 179 / 2e-54 PEN1, AT-SYR1, ATSYR1, ATSYP121, SYP121 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) AT1G11250 176 / 2e-53 ATSYP125, SYP125 syntaxin of plants 125 (.1) AT3G52400 160 / 8e-47 ATSYP122, SYP122 syntaxin of plants 122 (.1) AT3G03800 145 / 2e-41 ATSYP131, SYP131 syntaxin of plants 131 (.1) AT5G08080 145 / 3e-41 ATSYP132, SYP132 syntaxin of plants 132 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G023100 [exp] 465 / 5e-167 AT2G18260 352 / 3e-122 syntaxin of plants 112 (.1) Potri.009G117900 [exp] 312 / 5e-107 AT2G18260 298 / 4e-101 syntaxin of plants 112 (.1) Potri.013G053200 [exp] 233 / 2e-75 AT1G08560 430 / 8e-153 KNOLLE, syntaxin of plants 111 (.1) Potri.019G030800 [exp] 223 / 3e-71 AT1G08560 431 / 3e-153 KNOLLE, syntaxin of plants 111 (.1) Potri.011G043700 [exp] 204 / 3e-64 AT1G61290 456 / 3e-163 syntaxin of plants 124 (.1) Potri.004G035400 [exp] 203 / 8e-64 AT1G61290 490 / 8e-177 syntaxin of plants 124 (.1) Potri.016G068600 [exp] 193 / 4e-60 AT3G11820 421 / 5e-149 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Potri.006G202200 [exp] 188 / 4e-58 AT3G11820 412 / 3e-145 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Potri.019G036700 [exp] 152 / 4e-44 AT3G03800 391 / 1e-137 syntaxin of plants 131 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026005 [exp] 345 / 2e-119 AT2G18260 327 / 2e-112 syntaxin of plants 112 (.1) Lus10014297 [exp] 338 / 2e-116 AT2G18260 319 / 5e-109 syntaxin of plants 112 (.1) Lus10042527 [exp] 234 / 8e-76 AT1G08560 391 / 2e-137 KNOLLE, syntaxin of plants 111 (.1) Lus10021988 [exp] 232 / 5e-75 AT1G08560 388 / 2e-136 KNOLLE, syntaxin of plants 111 (.1) Lus10016173 [exp] 195 / 3e-60 AT3G11820 432 / 2e-152 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10029373 [exp] 193 / 7e-60 AT3G11820 441 / 4e-157 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10013589 [exp] 191 / 4e-59 AT3G11820 437 / 2e-155 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10006735 [exp] 189 / 2e-58 AT1G61290 491 / 3e-177 syntaxin of plants 124 (.1) Lus10018441 [exp] 189 / 2e-58 AT1G61290 491 / 4e-177 syntaxin of plants 124 (.1) Lus10021263 [exp] 188 / 2e-57 AT3G11820 436 / 3e-154 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0445 [poplar] [flax] SNARE-fusion PF00804 [poplar] [flax] Syntaxin Syntaxin
Representative CDS sequence Show only first row Show all	>Potri.005G121300.1 pacid=42803510 polypeptide=Potri.005G121300.1.p locus=Potri.005G121300 ID=Potri.005G121300.1.v4.1 annot-version=v4.1 ATGAATGATCTAATGACAAGATCGTTCTTAAGTTATGTGGAACTAAAGAAACAAGCCCAAAAGGACCTTCAAGTTGAACTCGACATTGAATCAGGCCAAC CCAACCTCTCTCAGTTCTTCCATGAAGTCAACGGAATCAAGACCGAAATGGAAGATATTACCAATCTCTTGTTTGATCTTCAAAACCTTAATGAAGAGTC AAAGTCCACTCACAGTGCCAAAGTTCTTCGTGGCTTAAGAGACCGAATGGAATCAGACATTGTTGCAGTTCTTAGAAAGGCCATGATTGTGAAGGCAAGA CTGGAATCACTTGACAGATCCAATATATCCAATCGCAGAGTATCAGAATTGTATAAAGAAGGGAGTCCTATTGATAGGACAAGGATATCAGTCACCAATG GCTCGAGAGTTAAGCTTAGGGAAATTATGAATGAATTTCACATCCTGAGACAGAAGATTTTATCAGATTACAAAAACGATCTGAAAAGAAGATACTACAC TGCGACTGGAGAGGAACCAAGTGAAGAAGAGATTGAAAATATGATTTCAGGAGGTGGGGGAGTTCAGATGTTTGAAGGGAAAGGAGTGATGGACTTGAAG AATAAAGAGAGGCATGAGGTTGTGATGGACATACAGAGAAGCTTGAAAAGGCTGCATCAGATGTTTCTTGATATGGTTGTTCTTATTGAAACACAGGGAG AGAAGATGGATGACATTGAAGAGAATGTGACCAATGCAGGTAATTTTTTAAGTGGTGGAACCAACAGTCTTTACCATGCAAATCAGATGAAGAAGAAGAG GAAGACATGGTTTTTATGGGTTTTTGCTGTGATGTTGATCATAATTTTTGTTTGCATTATATCAGAGACAGCATGGAAGGGAATTATTTGA
AA sequence Show only first row Show all	>Potri.005G121300.1 pacid=42803510 polypeptide=Potri.005G121300.1.p locus=Potri.005G121300 ID=Potri.005G121300.1.v4.1 annot-version=v4.1 MNDLMTRSFLSYVELKKQAQKDLQVELDIESGQPNLSQFFHEVNGIKTEMEDITNLLFDLQNLNEESKSTHSAKVLRGLRDRMESDIVAVLRKAMIVKAR LESLDRSNISNRRVSELYKEGSPIDRTRISVTNGSRVKLREIMNEFHILRQKILSDYKNDLKRRYYTATGEEPSEEEIENMISGGGGVQMFEGKGVMDLK NKERHEVVMDIQRSLKRLHQMFLDMVVLIETQGEKMDDIEENVTNAGNFLSGGTNSLYHANQMKKKRKTWFLWVFAVMLIIIFVCIISETAWKGII

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18260		ATSYP112, SYP11...	syntaxin of plants 112 (.1)		Potri.005G121300 [exp]	0	1	Pt-SYP112.2
AT5G05800			unknown protein		Potri.001G339400 [exp]	27.65	0.9400
AT1G02090		ATCSN7, COP15, ...	FUSCA 5, CONSTITUTIVE PHOTOMOR...		Potri.003G081066 [exp]	29.59	0.9398
AT5G05800			unknown protein		Potri.007G118701 [exp]	32.61	0.9397
					Potri.013G071200 [exp]	37.22	0.9388
AT1G77780			Glycosyl hydrolase superfamily...		Potri.010G088500 [exp]	40.07	0.9381
AT2G33460		RIC1	ROP-interactive CRIB motif-con...		Potri.008G168900 [exp]	46.43	0.9361	Pt-RIC1.1
AT4G01290			unknown protein		Potri.004G073400 [exp]	47.11	0.9360
AT3G04380		SDG31, SUVR4	SET DOMAIN PROTEIN 31, SET-dom...		Potri.009G138600 [exp]	52.48	0.9351
					Potri.006G128300 [exp]	53.66	0.9357
AT2G27770			Plant protein of unknown funct...		Potri.017G116200 [exp]	56.00	0.8814

Compare expression of checked genes

Potri.005G121300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.