Potri.005G126301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.005G126301.1 pacid=42803332 polypeptide=Potri.005G126301.1.p locus=Potri.005G126301 ID=Potri.005G126301.1.v4.1 annot-version=v4.1
ATGGAAGACAACCACTGGCCGCGACGTTCCACAGCTCCTCTGTCACGCAACAGCAACAACAATCCACACCAACACAAAACCAATTTCAGCCACCACTACA
CTAGTCCAACACTGGCAACAGCAGCAGCAGACCATCCTTCCCATCAACTCAACAAACCCTTCATCATTGGTCTTCCTCAACATACCAGCACAATGTCTCT
CACAGACTTACCAGCAGTTCAAATCACCACAACAAAATCGGTCAACACCAGCAGCAACCCTCATCCTTTCAACCACTGTCCGGATGAGAAAATCACATGG
AAAATCAGCACTCCACAGCAGCCACCAGCGACTTGA
AA sequence
>Potri.005G126301.1 pacid=42803332 polypeptide=Potri.005G126301.1.p locus=Potri.005G126301 ID=Potri.005G126301.1.v4.1 annot-version=v4.1
MEDNHWPRRSTAPLSRNSNNNPHQHKTNFSHHYTSPTLATAAADHPSHQLNKPFIIGLPQHTSTMSLTDLPAVQITTTKSVNTSSNPHPFNHCPDEKITW
KISTPQQPPAT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G126301 0 1
Potri.017G152460 1.00 0.9405
Potri.002G246900 2.00 0.9126
AT2G32600 hydroxyproline-rich glycoprote... Potri.006G121300 7.41 0.8938
AT1G06440 Ubiquitin carboxyl-terminal hy... Potri.002G245100 7.93 0.9115
Potri.006G239650 8.06 0.9009
AT2G31670 Stress responsive alpha-beta b... Potri.001G413500 9.48 0.9008
AT1G08610 Pentatricopeptide repeat (PPR)... Potri.019G019200 11.22 0.8877
AT2G45680 TCP TCP9 TCP family transcription facto... Potri.001G111800 14.56 0.9025
AT3G53560 Tetratricopeptide repeat (TPR)... Potri.006G213600 15.87 0.8951
AT1G05750 PDE247, CLB19 pigment defective 247, Tetratr... Potri.001G217600 17.74 0.8962

Potri.005G126301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.