Potri.005G126500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36800 332 / 3e-118 RCE1 RUB1 conjugating enzyme 1 (.1.2)
AT2G18600 310 / 2e-109 Ubiquitin-conjugating enzyme family protein (.1)
AT3G08690 99 / 1e-26 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT2G16740 99 / 2e-26 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT5G41700 99 / 2e-26 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT5G56150 98 / 2e-26 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT5G53300 98 / 2e-26 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT4G27960 97 / 1e-25 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT1G64230 96 / 2e-25 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT3G08700 92 / 6e-24 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G030900 360 / 2e-129 AT4G36800 340 / 2e-121 RUB1 conjugating enzyme 1 (.1.2)
Potri.T125904 337 / 3e-120 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2)
Potri.009G113045 337 / 3e-120 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2)
Potri.014G041532 130 / 4e-39 AT4G36800 137 / 5e-42 RUB1 conjugating enzyme 1 (.1.2)
Potri.014G041466 104 / 8e-30 AT2G18600 104 / 3e-30 Ubiquitin-conjugating enzyme family protein (.1)
Potri.004G175000 98 / 3e-26 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.019G131400 96 / 1e-25 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.011G168200 96 / 2e-25 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G094900 96 / 2e-25 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026038 346 / 1e-123 AT4G36800 341 / 1e-121 RUB1 conjugating enzyme 1 (.1.2)
Lus10014329 338 / 2e-119 AT4G36800 332 / 3e-117 RUB1 conjugating enzyme 1 (.1.2)
Lus10010143 250 / 7e-86 AT4G36800 257 / 1e-88 RUB1 conjugating enzyme 1 (.1.2)
Lus10028700 99 / 1e-26 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10009422 99 / 1e-26 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10027846 99 / 2e-26 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 97 / 1e-25 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10027570 95 / 5e-25 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 95 / 5e-25 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10005072 100 / 8e-25 AT4G27960 291 / 3e-98 ubiquitin conjugating enzyme 9 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Potri.005G126500.1 pacid=42802993 polypeptide=Potri.005G126500.1.p locus=Potri.005G126500 ID=Potri.005G126500.1.v4.1 annot-version=v4.1
ATGATTCGGCTATTTAAAGTGAAGGAAAAGCAGAGAGAACTTGCTGAAAATGCTAATGGTGGTGTACCGATCAAGAAGCAAACTGCTGGAGAATTGCGTC
TTCATAAGGATATTTCTGAGTTGAACCTACCTACATCATGCAACATGATGTTCCCCAATGGCAAGGACGACCTTATGAACTTTGAGGTTTCTATCCGACC
AGATGAAGGATATTATTTAGGTGGAATGTTTTTGTTCTCTTTTCAAGTTTCACCAATCTATCCACATGAAGCACCGAAAGTTAAGTGCAAGACCAAGGTC
TACCATCCAAACATCGATTTAGAAGGAAATGTCTGCCTCAATATCTTGCGAGAAGATTGGAAACCTGTCCTCAGTGTAAACACTATCATTTACGGATTAT
ATCATCTCTTCACGGAACCAAATTGCGAGGATCCTCTTAATCATGATGCTGCTGCAGTGTTGAGGGATAACCCTAAGATGTTTGAATCTCATGTGAGAAG
GGCTTTGGCAGGCGGGTATGTGGGGCAAACCTTCTTTCCACGATGTATTTAG
AA sequence
>Potri.005G126500.1 pacid=42802993 polypeptide=Potri.005G126500.1.p locus=Potri.005G126500 ID=Potri.005G126500.1.v4.1 annot-version=v4.1
MIRLFKVKEKQRELAENANGGVPIKKQTAGELRLHKDISELNLPTSCNMMFPNGKDDLMNFEVSIRPDEGYYLGGMFLFSFQVSPIYPHEAPKVKCKTKV
YHPNIDLEGNVCLNILREDWKPVLSVNTIIYGLYHLFTEPNCEDPLNHDAAAVLRDNPKMFESHVRRALAGGYVGQTFFPRCI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G36800 RCE1 RUB1 conjugating enzyme 1 (.1.... Potri.005G126500 0 1
AT1G02816 Protein of unknown function, D... Potri.013G014600 1.73 0.8157
AT2G24765 ARF3, ARL1, ATA... ARF-LIKE 1, ADP-ribosylation f... Potri.018G013700 2.00 0.8191
AT4G22310 Uncharacterised protein family... Potri.011G023100 3.46 0.8230
AT1G09920 TRAF-type zinc finger-related ... Potri.002G109800 4.24 0.7608
AT1G11890 ATSEC22, SEC22 SECRETION 22, Synaptobrevin fa... Potri.003G069900 4.89 0.7853 SEC22.2
AT3G11780 MD-2-related lipid recognition... Potri.016G067800 8.24 0.7013
AT3G18430 Calcium-binding EF-hand family... Potri.018G103600 8.36 0.7596
AT4G17170 ATRAB-B1B, AT-R... ARABIDOPSIS RAB GTPASE HOMOLOG... Potri.016G002200 10.48 0.6740 RAB2.1
AT5G55290 ATPase, V0 complex, subunit E ... Potri.001G359600 11.31 0.7619
AT4G39220 ATRER1A Rer1 family protein (.1) Potri.009G118500 14.49 0.7393

Potri.005G126500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.