Potri.005G126802 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G09380 52 / 1e-09 RNA polymerase III RPC4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G143500 122 / 5e-36 AT5G09380 231 / 3e-75 RNA polymerase III RPC4 (.1)
Potri.005G126700 116 / 7e-34 AT5G09380 226 / 2e-73 RNA polymerase III RPC4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019022 53 / 7e-10 AT5G09380 191 / 4e-59 RNA polymerase III RPC4 (.1)
Lus10000362 51 / 3e-09 AT4G25180 69 / 1e-13 RNA polymerase III RPC4 (.1)
PFAM info
Representative CDS sequence
>Potri.005G126802.1 pacid=42805370 polypeptide=Potri.005G126802.1.p locus=Potri.005G126802 ID=Potri.005G126802.1.v4.1 annot-version=v4.1
ATGGAGTCCAAACCTCCACAAGATGCCCAGAGGAAGTATAGGTTTATGCCTGAAGCTCCTCCACGCCGAGTTCCAAAGCCGGAAGTTAAAACTGAAAAGG
TGGAGAATGTGGATACTCTACAGGCCATGAACTTGATGAAGCAATTCCAGAAAAGGTCCCTAAAGCAAAAGATTACAAACGGAAAGAAAGGTAAGTCCCT
TTCTTAA
AA sequence
>Potri.005G126802.1 pacid=42805370 polypeptide=Potri.005G126802.1.p locus=Potri.005G126802 ID=Potri.005G126802.1.v4.1 annot-version=v4.1
MESKPPQDAQRKYRFMPEAPPRRVPKPEVKTEKVENVDTLQAMNLMKQFQKRSLKQKITNGKKGKSLS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G09380 RNA polymerase III RPC4 (.1) Potri.005G126802 0 1
Potri.006G196950 21.26 0.7924
Potri.019G036220 28.93 0.7871
AT3G54070 Ankyrin repeat family protein ... Potri.011G016966 33.58 0.7836
Potri.008G079750 38.41 0.7799
AT3G54070 Ankyrin repeat family protein ... Potri.011G016400 51.43 0.7747
AT5G49700 AT-hook Predicted AT-hook DNA-binding ... Potri.005G156700 56.20 0.7735
AT3G54070 Ankyrin repeat family protein ... Potri.006G281500 59.59 0.7738
AT4G26590 ATOPT5 ARABIDOPSIS THALIANA OLIGOPEPT... Potri.001G370100 60.31 0.7694 Pt-OPT1.1
Potri.004G166400 63.38 0.7720
Potri.001G000450 70.31 0.6911

Potri.005G126802 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.