Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50770 188 / 9e-61 CML41 calmodulin-like 41 (.1) AT1G76650 108 / 4e-30 CML38 calmodulin-like 38 (.1.2.3) AT1G76640 103 / 4e-28 Calcium-binding EF-hand family protein (.1) AT1G24620 99 / 3e-26 EF hand calcium-binding protein family (.1) AT1G18210 96 / 4e-25 Calcium-binding EF-hand family protein (.1.2) AT5G42380 95 / 1e-24 CML39, CML37 CALMODULIN LIKE 39, calmodulin like 37 (.1) AT5G37770 93 / 5e-24 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT5G21274 92 / 6e-24 ACAM-6, CAM6 calmodulin 6 (.1) AT1G73630 92 / 8e-24 EF hand calcium-binding protein family (.1) AT3G43810 91 / 1e-23 CAM7 calmodulin 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G031900 [exp] 284 / 5e-99 AT3G50770 147 / 1e-44 calmodulin-like 41 (.1) Potri.005G259900 [exp] 143 / 3e-43 AT1G76650 156 / 2e-48 calmodulin-like 38 (.1.2.3) Potri.002G001400 [exp] 133 / 1e-39 AT5G42380 160 / 6e-50 CALMODULIN LIKE 39, calmodulin like 37 (.1) Potri.001G332900 [exp] 115 / 5e-33 AT1G76650 115 / 2e-33 calmodulin-like 38 (.1.2.3) Potri.002G132500 [exp] 99 / 1e-26 AT5G42380 98 / 1e-26 CALMODULIN LIKE 39, calmodulin like 37 (.1) Potri.008G134300 [exp] 100 / 2e-26 AT1G24620 219 / 2e-73 EF hand calcium-binding protein family (.1) Potri.015G093800 [exp] 99 / 2e-26 AT1G76650 101 / 8e-28 calmodulin-like 38 (.1.2.3) Potri.015G032600 [exp] 97 / 1e-25 AT5G37780 284 / 3e-100 TOUCH 1, calmodulin 1 (.1.2.3) Potri.010G107100 [exp] 97 / 4e-25 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032734 [exp] 162 / 2e-50 AT3G50770 153 / 5e-47 calmodulin-like 41 (.1) Lus10022343 [exp] 116 / 3e-33 AT1G76650 132 / 7e-40 calmodulin-like 38 (.1.2.3) Lus10018012 [exp] 98 / 7e-26 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10027283 [exp] 91 / 2e-23 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10038981 [exp] 91 / 2e-23 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10037423 [exp] 91 / 2e-23 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10041288 [exp] 91 / 2e-23 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10004330 [exp] 89 / 1e-22 AT1G24620 207 / 2e-69 EF hand calcium-binding protein family (.1) Lus10028913 [exp] 89 / 2e-22 AT1G24620 204 / 5e-68 EF hand calcium-binding protein family (.1) Lus10009059 [exp] 88 / 8e-22 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair CL0220 [poplar] [flax] EF_hand PF13833 [poplar] [flax] EF-hand_8 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.005G128100.1 pacid=42802341 polypeptide=Potri.005G128100.1.p locus=Potri.005G128100 ID=Potri.005G128100.1.v4.1 annot-version=v4.1 ATGGCAACTGATAGAGTTTCAAAATCATCTAAGTGGTTCTCTAACAAGGGTCTGAGGTTAAGTCTCCATCGTCGTAGATCAAAGTCTAGTTCAACGTTAA GCTCTCCTAACTCCCTCATGTCCCCATATACACCAAAAAAGGGTAGAGCTAGAGAAGATGAGCTAAAAGAAGTTTTTCGTCATTTCGATAGTGATGGTGA TGGAAGGATCTCAGCCCTAGAGCTTAGGGCATACTTTAGATCCATAGGGGAGTACATGTCACATGAAGAGGCACAATCAGCGATCAACGATCTTGATGCA GACCAGGACAACATGTTGGACTTCCAAGACTTTTTGAGGCTAATGAAGAGGGAGGCTAATGATTATGATGATGATCTCAAAATGGCCTTTGAGATGTTTG AAATGGAGAAGGGATCGGGGTACATAACACCTAAGGGCTTGCAAAGGATGCTGCATCGACTAGGAGATGCAAAGTCTTATGATGACTGCGTGGCCATGAT TCATGTTTTTGATATTGATGGTAATGGAGTCCTTGATTTTCATGAGTTTAATCAAATGATGGCCTGA
AA sequence Show only first row Show all	>Potri.005G128100.1 pacid=42802341 polypeptide=Potri.005G128100.1.p locus=Potri.005G128100 ID=Potri.005G128100.1.v4.1 annot-version=v4.1 MATDRVSKSSKWFSNKGLRLSLHRRRSKSSSTLSSPNSLMSPYTPKKGRAREDELKEVFRHFDSDGDGRISALELRAYFRSIGEYMSHEEAQSAINDLDA DQDNMLDFQDFLRLMKREANDYDDDLKMAFEMFEMEKGSGYITPKGLQRMLHRLGDAKSYDDCVAMIHVFDIDGNGVLDFHEFNQMMA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G50770		CML41	calmodulin-like 41 (.1)		Potri.005G128100 [exp]	0	1
AT2G47890	CO	COL13	B-box type zinc finger protein...		Potri.014G134601 [exp]	1.00	0.9807
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Potri.001G168000 [exp]	3.46	0.9620
AT5G63520			unknown protein		Potri.004G005700 [exp]	6.00	0.9538
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Potri.016G127000 [exp]	7.93	0.9511
AT1G68040			S-adenosyl-L-methionine-depend...		Potri.019G016112 [exp]	9.38	0.9561
AT1G66910			Protein kinase superfamily pro...		Potri.015G018101 [exp]	11.09	0.9571
AT5G22510		INV-E, At-A/N-I...	Arabidopsis alkaline/neutral i...		Potri.010G236100 [exp]	11.22	0.9444
AT4G37340		CYP81D3	"cytochrome P450, family 81, s...		Potri.002G121200 [exp]	11.40	0.9479	Pt-IFS1.43
AT4G27680			P-loop containing nucleoside t...		Potri.011G055212 [exp]	11.48	0.9332
AT3G52070			unknown protein		Potri.009G059100 [exp]	12.00	0.9423

Compare expression of checked genes

Potri.005G128100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.