Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32700 86 / 1e-20 PLATZ transcription factor family protein (.1.2) AT2G27930 82 / 2e-19 PLATZ transcription factor family protein (.1) AT4G17900 79 / 5e-18 PLATZ transcription factor family protein (.1.2) AT1G21000 77 / 7e-17 PLATZ transcription factor family protein (.1.2) AT1G76590 76 / 1e-16 PLATZ transcription factor family protein (.1) AT1G43000 72 / 2e-15 PLATZ transcription factor family protein (.1) AT3G60670 67 / 1e-13 PLATZ transcription factor family protein (.1) AT5G46710 66 / 4e-13 PLATZ transcription factor family protein (.1) AT1G31040 62 / 2e-11 PLATZ transcription factor family protein (.1) AT2G01818 60 / 6e-11 PLATZ transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G119400 [exp] 87 / 5e-21 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1) Potri.016G097100 [exp] 85 / 3e-20 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2) Potri.001G212400 [exp] 82 / 4e-19 AT2G27930 224 / 6e-75 PLATZ transcription factor family protein (.1) Potri.009G003200 [exp] 81 / 1e-18 AT2G27930 227 / 3e-76 PLATZ transcription factor family protein (.1) Potri.013G078500 [exp] 81 / 2e-18 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2) Potri.005G259000 [exp] 80 / 4e-18 AT1G21000 366 / 1e-129 PLATZ transcription factor family protein (.1.2) Potri.003G092800 [exp] 78 / 1e-17 AT4G17900 290 / 5e-100 PLATZ transcription factor family protein (.1.2) Potri.001G141500 [exp] 78 / 2e-17 AT4G17900 302 / 5e-105 PLATZ transcription factor family protein (.1.2) Potri.002G002200 [exp] 77 / 2e-17 AT1G21000 365 / 2e-129 PLATZ transcription factor family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027735 [exp] 93 / 3e-23 AT1G21000 218 / 9e-72 PLATZ transcription factor family protein (.1.2) Lus10035554 [exp] 92 / 7e-23 AT1G21000 221 / 4e-73 PLATZ transcription factor family protein (.1.2) Lus10040292 [exp] 83 / 3e-19 AT1G21000 317 / 3e-110 PLATZ transcription factor family protein (.1.2) Lus10030968 [exp] 82 / 5e-19 AT4G17900 299 / 1e-103 PLATZ transcription factor family protein (.1.2) Lus10040082 [exp] 80 / 5e-18 AT4G17900 306 / 2e-106 PLATZ transcription factor family protein (.1.2) Lus10023411 [exp] 81 / 6e-18 AT1G21000 313 / 7e-107 PLATZ transcription factor family protein (.1.2) Lus10000952 [exp] 77 / 4e-17 AT1G21000 347 / 5e-122 PLATZ transcription factor family protein (.1.2) Lus10002700 [exp] 78 / 5e-17 AT1G21000 345 / 1e-120 PLATZ transcription factor family protein (.1.2) Lus10004577 [exp] 77 / 5e-17 AT4G17900 287 / 6e-99 PLATZ transcription factor family protein (.1.2) Lus10014396 [exp] 75 / 2e-16 AT1G76590 202 / 7e-66 PLATZ transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04640 [poplar] [flax] PLATZ PLATZ transcription factor
Representative CDS sequence Show only first row Show all	>Potri.005G130300.2 pacid=42804504 polypeptide=Potri.005G130300.2.p locus=Potri.005G130300 ID=Potri.005G130300.2.v4.1 annot-version=v4.1 ATGGGGGAGCATGCAACTTATCCTCAATGGCTACTGCACTTGATAGAAACAGAATTTTACGAGCTGTGTGAAAATCATAGCGATCCAAATAGAGCAAAAC ACTGCAACTTCTTCTGTGTGGATTGCACTAAATCACCACCGTTCTGTGACCACTGCAACAGCAACAATGTGCATAAAGGGCACCAAGTCATCCAAGTTTA CAGATCTTCATACAGTCCAGGAATCAAAATACCTGTGATAAGAACACTGTTCGATATATCCGAGATTCAGCCATATTCCATAAATAGGAATTCTATTATT TATATTCAACAAAGAACTTCAAAAGAGAATAGTAATGGATCGGTAATAAATCAAAGTCAAAGACCTCTGAGCAATCACAACTACAGTGAAACAAATCATA AGAGAAAACGTAGGTGTGAATCATGTCAATGGGAGCTGACGACATTAGAAGATTCATCTCATAACTACAAGTTTTGCTCGGTGGAATGCAAAGTTAAAGG ATCAAAGCCTTCAAGACAAATAGAAGATGATATTGAGGTCTTTGGTTCCATCAATGGGTGTGACGAGCAGTATTGTTATGCTGGTAGAAAAAGAAGAAAA AGTATTCCCAGAAGGTCTCCTTTATCTTAG
AA sequence Show only first row Show all	>Potri.005G130300.2 pacid=42804504 polypeptide=Potri.005G130300.2.p locus=Potri.005G130300 ID=Potri.005G130300.2.v4.1 annot-version=v4.1 MGEHATYPQWLLHLIETEFYELCENHSDPNRAKHCNFFCVDCTKSPPFCDHCNSNNVHKGHQVIQVYRSSYSPGIKIPVIRTLFDISEIQPYSINRNSII YIQQRTSKENSNGSVINQSQRPLSNHNYSETNHKRKRRCESCQWELTTLEDSSHNYKFCSVECKVKGSKPSRQIEDDIEVFGSINGCDEQYCYAGRKRRK SIPRRSPLS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G32700			PLATZ transcription factor fam...		Potri.005G130300 [exp]	0	1
					Potri.018G060100 [exp]	1.00	1.0000
AT2G01260			Protein of unknown function (D...		Potri.019G119100 [exp]	4.12	0.8881
AT5G53040		GRD, RKD4	RWP-RK domain-containing 4, GR...		Potri.015G011800 [exp]	7.93	0.9147
AT2G37030			SAUR-like auxin-responsive pro...		Potri.008G037900 [exp]	10.95	0.8940	SAUR40
AT4G27590			Heavy metal transport/detoxifi...		Potri.012G007200 [exp]	12.96	0.8448
					Potri.001G459001 [exp]	15.29	0.9116
AT5G64260		EXL2, MSJ1.10	EXORDIUM like 2 (.1)		Potri.014G126000 [exp]	16.73	0.8136
AT5G40780		LHT1, LTH1	lysine histidine transporter 1...		Potri.010G055800 [exp]	20.85	0.8363
AT1G37140		MCT1	MEI2 C-terminal RRM only like ...		Potri.002G088200 [exp]	22.84	0.8861
AT3G18010	HD	WOX1	WUSCHEL related homeobox 1 (.1...		Potri.010G111400 [exp]	22.97	0.8896

Compare expression of checked genes

Potri.005G130300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.