Potri.005G137450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.005G137450.1 pacid=42805692 polypeptide=Potri.005G137450.1.p locus=Potri.005G137450 ID=Potri.005G137450.1.v4.1 annot-version=v4.1
ATGGATGATGAACAAGGAACGATGAAGAAGCGTTCTGGGATTTGGGCACAGTCAAGAGGGGATAAATATAAAACCATGCGTTTTATTGTGGAGATGATGA
AGAGGCAATACGCTTCCATGGAGTTTCTCTTTTTTAGTGAGAGAGAAGGGCTTTCAATACGTGGGCCCCACAAGATGGGATGGGCCCACCTTCAAAAGGA
GCGACAGGAGGTATCTCTCTATCCTCCAGCATCGGATTCCAAAATTTGTCCTCACGGGGCTCACAGAAAGCGACAGATCGTCGCAGCATGTGGCATGGCC
GCATTTTATCCGCGGGGGCGGGGGCCCTGA
AA sequence
>Potri.005G137450.1 pacid=42805692 polypeptide=Potri.005G137450.1.p locus=Potri.005G137450 ID=Potri.005G137450.1.v4.1 annot-version=v4.1
MDDEQGTMKKRSGIWAQSRGDKYKTMRFIVEMMKRQYASMEFLFFSEREGLSIRGPHKMGWAHLQKERQEVSLYPPASDSKICPHGAHRKRQIVAACGMA
AFYPRGRGP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G137450 0 1
AT3G05030 ATNHX2, NHX2 sodium hydrogen exchanger 2 (.... Potri.014G134900 1.00 0.8645 NHX1.2
AT2G24610 ATCNGC14 cyclic nucleotide-gated channe... Potri.018G009200 4.89 0.8454 Pt-ATCNGC14.1
AT5G59970 Histone superfamily protein (.... Potri.018G093000 5.91 0.8188 HFO907,Pt-HIS4.1
AT1G16560 Per1-like family protein (.1.2... Potri.015G136600 9.79 0.8277
AT2G16600 ROC3 rotamase CYP 3 (.1.2) Potri.002G021500 10.24 0.8429 CYP1.2
AT5G26770 unknown protein Potri.013G003400 16.79 0.7698
AT4G29040 RPT2A regulatory particle AAA-ATPase... Potri.014G194700 17.14 0.8152
AT1G73040 Mannose-binding lectin superfa... Potri.012G140001 17.23 0.8094
AT1G28310 DOF AtDof1. 4 Dof-type zinc finger DNA-bindi... Potri.004G046600 25.61 0.8103
AT5G07610 F-box family protein (.1) Potri.013G067800 30.59 0.7918

Potri.005G137450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.