Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33985 139 / 2e-42 Protein of unknown function (DUF1685) (.1) AT3G50350 122 / 1e-35 Protein of unknown function (DUF1685) (.1), Protein of unknown function (DUF1685) (.2) AT2G15590 112 / 5e-32 Protein of unknown function (DUF1685) (.1), Protein of unknown function (DUF1685) (.2) AT1G08790 90 / 7e-23 Protein of unknown function (DUF1685) (.1) AT2G43340 86 / 3e-21 Protein of unknown function (DUF1685) (.1) AT5G28690 85 / 8e-21 Protein of unknown function (DUF1685) (.1) AT3G04700 83 / 4e-20 Protein of unknown function (DUF1685) (.1) AT1G05870 82 / 7e-20 Protein of unknown function (DUF1685) (.1), Protein of unknown function (DUF1685) (.2), Protein of unknown function (DUF1685) (.3), Protein of unknown function (DUF1685) (.4) AT2G15610 81 / 9e-20 Protein of unknown function (DUF1685) (.1) AT2G31560 82 / 1e-19 Protein of unknown function (DUF1685) (.1), Protein of unknown function (DUF1685) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G043900 [exp] 223 / 6e-75 AT4G33985 134 / 3e-40 Protein of unknown function (DUF1685) (.1) Potri.009G101300 [exp] 122 / 9e-36 AT4G33985 130 / 2e-39 Protein of unknown function (DUF1685) (.1) Potri.013G042400 [exp] 101 / 5e-27 AT1G08790 151 / 2e-46 Protein of unknown function (DUF1685) (.1) Potri.005G055100 [exp] 94 / 5e-24 AT1G08790 126 / 1e-36 Protein of unknown function (DUF1685) (.1) Potri.007G126700 [exp] 85 / 1e-20 AT1G05870 188 / 7e-61 Protein of unknown function (DUF1685) (.1), Protein of unknown function (DUF1685) (.2), Protein of unknown function (DUF1685) (.3), Protein of unknown function (DUF1685) (.4) Potri.017G032800 [exp] 79 / 1e-18 AT1G05870 190 / 1e-61 Protein of unknown function (DUF1685) (.1), Protein of unknown function (DUF1685) (.2), Protein of unknown function (DUF1685) (.3), Protein of unknown function (DUF1685) (.4) Potri.014G111000 [exp] 39 / 0.0007 AT2G46940 148 / 4e-43 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002400 [exp] 117 / 2e-33 AT4G33985 150 / 7e-47 Protein of unknown function (DUF1685) (.1) Lus10027898 [exp] 113 / 5e-32 AT4G33985 141 / 2e-43 Protein of unknown function (DUF1685) (.1) Lus10014064 [exp] 110 / 7e-31 AT4G33985 145 / 2e-45 Protein of unknown function (DUF1685) (.1) Lus10019852 [exp] 103 / 2e-28 AT4G33985 149 / 9e-47 Protein of unknown function (DUF1685) (.1) Lus10006560 [exp] 103 / 3e-28 AT1G08790 166 / 2e-52 Protein of unknown function (DUF1685) (.1) Lus10042536 [exp] 93 / 2e-24 AT1G08790 141 / 2e-43 Protein of unknown function (DUF1685) (.1) Lus10021997 [exp] 92 / 4e-24 AT1G08790 129 / 4e-39 Protein of unknown function (DUF1685) (.1) Lus10027022 [exp] 81 / 5e-19 AT2G31560 183 / 1e-58 Protein of unknown function (DUF1685) (.1), Protein of unknown function (DUF1685) (.2) Lus10025562 [exp] 81 / 5e-19 AT1G05870 183 / 1e-58 Protein of unknown function (DUF1685) (.1), Protein of unknown function (DUF1685) (.2), Protein of unknown function (DUF1685) (.3), Protein of unknown function (DUF1685) (.4) Lus10005536 [exp] 65 / 1e-13 AT5G28690 119 / 3e-35 Protein of unknown function (DUF1685) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07939 [poplar] [flax] DUF1685 Protein of unknown function (DUF1685)
Representative CDS sequence Show only first row Show all	>Potri.005G138100.1 pacid=42802561 polypeptide=Potri.005G138100.1.p locus=Potri.005G138100 ID=Potri.005G138100.1.v4.1 annot-version=v4.1 ATGTCCCTCCCCTACCCCCGCCCGCCGCCACCACCTCGAGAAGAACAAATAGAATATCAACCACCCATACGAAAACAGCATCAACAACAACTACTAGGGC CGTCTCCACTTTACAAACAACATTCATGGTCACCTGATATTTACAGGGACGAGGCGTGGCTAAGGAGGAAAGGAAACTATAAGAAAAAGAAATGCAAAAG CGTTACTGATGAAGATCTCGATGAGCTTAAAGGTTGTATTGAGTTAGGTTTTGGGTTTGACTCTCCAGAAATGGATCAACGTTTGTCTGATACTTTTCCT GCTTTGGAACTTTATTATGCTGTCAACAAGAACTACCATGACCATTCCGTCTCCAAGCCTTTCACTGATACGTCGTCTTCGTCCATGGCGTCTGATTGTG ATTCACTCTCTCCCCTAGGTAGCCCTCACAACATTTTTGGTCCAGGTGACAATCCACAGACGGTGAAGACAAGGCTAAAGCAGTGGGCACAGGTGGTTGC TTGTTCGGTGAGGCAGAGTTCAAGTTCAAGCTGA
AA sequence Show only first row Show all	>Potri.005G138100.1 pacid=42802561 polypeptide=Potri.005G138100.1.p locus=Potri.005G138100 ID=Potri.005G138100.1.v4.1 annot-version=v4.1 MSLPYPRPPPPPREEQIEYQPPIRKQHQQQLLGPSPLYKQHSWSPDIYRDEAWLRRKGNYKKKKCKSVTDEDLDELKGCIELGFGFDSPEMDQRLSDTFP ALELYYAVNKNYHDHSVSKPFTDTSSSSMASDCDSLSPLGSPHNIFGPGDNPQTVKTRLKQWAQVVACSVRQSSSSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33985			Protein of unknown function (D...		Potri.005G138100 [exp]	0	1
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Potri.001G094700 [exp]	2.23	0.8032
AT3G18280			Bifunctional inhibitor/lipid-t...		Potri.012G054300 [exp]	3.46	0.7752
AT3G18280			Bifunctional inhibitor/lipid-t...		Potri.015G044500 [exp]	5.91	0.7448
AT5G45030			Trypsin family protein (.1.2)		Potri.011G143200 [exp]	7.74	0.7280
AT3G55550			Concanavalin A-like lectin pro...		Potri.006G144850 [exp]	8.83	0.7155
AT5G05830			RING/FYVE/PHD zinc finger supe...		Potri.009G039700 [exp]	9.59	0.7630
AT5G54160		ATOMT1	O-methyltransferase 1 (.1)		Potri.002G076766 [exp]	12.24	0.6747
AT5G65260			RNA-binding (RRM/RBD/RNP motif...		Potri.001G311600 [exp]	13.49	0.7127
AT3G11760			unknown protein		Potri.016G067600 [exp]	13.78	0.7013
AT2G18110			Translation elongation factor...		Potri.009G018600 [exp]	15.58	0.7287

Compare expression of checked genes

Potri.005G138100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.