Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67070 118 / 3e-35 RALFL34 ralf-like 34 (.1) AT3G16570 55 / 2e-10 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT4G15800 54 / 3e-10 RALFL33 ralf-like 33 (.1) AT1G02900 54 / 3e-10 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT2G33775 54 / 4e-10 RALFL19 ralf-like 19 (.1) AT3G05490 54 / 5e-10 RALFL22 ralf-like 22 (.1) AT1G28270 47 / 1e-07 RALFL4 ralf-like 4 (.1) AT3G25170 42 / 6e-06 RALFL26 ralf-like 26 (.1) AT3G23805 42 / 1e-05 RALFL24 ralf-like 24 (.1) AT4G13950 41 / 3e-05 RALFL31 ralf-like 31 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G044700 [exp] 197 / 2e-66 AT5G67070 119 / 1e-35 ralf-like 34 (.1) Potri.014G026900 [exp] 106 / 1e-30 AT5G67070 94 / 6e-26 ralf-like 34 (.1) Potri.004G044900 [exp] 61 / 8e-13 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G045000 [exp] 61 / 1e-12 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.008G208200 [exp] 61 / 1e-12 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.013G017400 [exp] 57 / 3e-11 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.005G025800 [exp] 56 / 1e-10 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.014G131800 [exp] 52 / 2e-09 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.017G059800 [exp] 47 / 1e-07 AT4G14010 70 / 1e-16 ralf-like 32 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003931 [exp] 105 / 1e-29 AT5G67070 112 / 6e-33 ralf-like 34 (.1) Lus10001132 [exp] 89 / 2e-23 AT5G67070 100 / 4e-28 ralf-like 34 (.1) Lus10037460 [exp] 81 / 2e-18 AT1G53800 387 / 3e-126 unknown protein Lus10029893 [exp] 59 / 5e-12 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10000502 [exp] 58 / 1e-11 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10020647 [exp] 56 / 7e-11 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10037512 [exp] 56 / 8e-11 AT4G15800 131 / 9e-41 ralf-like 33 (.1) Lus10015172 [exp] 52 / 1e-09 AT4G15800 107 / 2e-31 ralf-like 33 (.1) Lus10015431 [exp] 46 / 3e-07 AT1G28270 81 / 7e-21 ralf-like 4 (.1) Lus10025444 [exp] 45 / 7e-07 AT1G28270 100 / 2e-28 ralf-like 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [poplar] [flax] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Potri.005G139100.2 pacid=42804378 polypeptide=Potri.005G139100.2.p locus=Potri.005G139100 ID=Potri.005G139100.2.v4.1 annot-version=v4.1 ATGGCAGCTTCTACATTGCAATACCATTTCGCCTTCTTCATCTTCTTTCTCGTAATTGCTTCTTTCAGTCCAAGAATCCAAGCTCAAGTTGATGAAACAA GCTTGAAGGCAATGAGAGATGCACTAGAATGGCCAATGTCCATGTATTATGATGAAAGCAGCGGTCTCAATGATGGGTTAGTGGGTTTTGACGATGGAGT TGTTGACGATGAAGAAAGTAGTCGTAGATCTTTGTTTTGGAGGAGAACGCATTATTATATCTCGTATGGAGCTTTGTCTGCTAATAGAATTCCTTGTCCA GCGAGGTCCGGGCGATCCTACTACAGCCACAATTGCTTCGCGTCTAGAGCTCCAGTGAATCCCTATTCCAGAGGGTGTTCTAGGATCGCTCGTTGCAGGA GATGA
AA sequence Show only first row Show all	>Potri.005G139100.2 pacid=42804378 polypeptide=Potri.005G139100.2.p locus=Potri.005G139100 ID=Potri.005G139100.2.v4.1 annot-version=v4.1 MAASTLQYHFAFFIFFLVIASFSPRIQAQVDETSLKAMRDALEWPMSMYYDESSGLNDGLVGFDDGVVDDEESSRRSLFWRRTHYYISYGALSANRIPCP ARSGRSYYSHNCFASRAPVNPYSRGCSRIARCRR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G67070		RALFL34	ralf-like 34 (.1)		Potri.005G139100 [exp]	0	1
AT1G10380			Putative membrane lipoprotein ...		Potri.010G158500 [exp]	1.00	0.9114
AT4G13600			Carbohydrate-binding X8 domain...		Potri.017G055700 [exp]	1.41	0.8905
AT1G45207			Remorin family protein (.2)		Potri.014G027900 [exp]	2.44	0.8732
AT1G75060			unknown protein		Potri.014G041200 [exp]	3.74	0.8643
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Potri.015G057800 [exp]	5.65	0.8716
AT5G39950		ATTRXH2, ATTRX2...	Arabidopsis thioredoxin h2, th...		Potri.017G076700 [exp]	5.74	0.8508	PtrTrxh2
AT3G48610		NPC6	non-specific phospholipase C6 ...		Potri.012G099300 [exp]	7.48	0.8165
AT1G10380			Putative membrane lipoprotein ...		Potri.008G095900 [exp]	8.66	0.8190
AT1G47740			PPPDE putative thiol peptidase...		Potri.009G113168 [exp]	10.95	0.8565
AT1G70550			Protein of Unknown Function (D...		Potri.008G188000 [exp]	11.61	0.8171

Compare expression of checked genes

Potri.005G139100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.