Potri.005G140500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G67170 402 / 2e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT3G22260 75 / 3e-15 Cysteine proteinases superfamily protein (.1.2.3)
AT3G02070 73 / 1e-14 Cysteine proteinases superfamily protein (.1)
AT5G04250 71 / 2e-13 Cysteine proteinases superfamily protein (.1.2)
AT2G27350 67 / 5e-12 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
AT5G03330 66 / 1e-11 Cysteine proteinases superfamily protein (.1.2)
AT3G62940 53 / 1e-07 Cysteine proteinases superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G019700 76 / 7e-16 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G021700 73 / 1e-14 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 72 / 3e-14 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.004G196800 73 / 8e-14 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.009G160100 72 / 2e-13 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.010G225400 69 / 7e-13 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.016G094700 65 / 2e-11 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036900 62 / 3e-11 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.006G125900 64 / 6e-11 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006255 412 / 5e-143 AT5G67170 363 / 7e-124 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Lus10010459 75 / 3e-15 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10023019 76 / 7e-15 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10001404 76 / 8e-15 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10005193 73 / 1e-13 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10027312 69 / 5e-13 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10013813 69 / 8e-13 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10026525 68 / 2e-12 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10038708 65 / 2e-11 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10013303 65 / 5e-11 AT2G27350 468 / 7e-162 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.005G140500.22 pacid=42803150 polypeptide=Potri.005G140500.22.p locus=Potri.005G140500 ID=Potri.005G140500.22.v4.1 annot-version=v4.1
ATGGTAAAAACCAAACAGCAGAAGTCCAAACCCAAGAAAACTCCCCATGTGAAAAAACAGGGAAAGCAGGCCAATATCGTGCAGTTTCGCGCTCAGCTTG
ATGCATTGGGCCTAAAAATTATCGAAGTGACTGCAGATGGTAATTGTTTTTTCAGGGGACTTGCAGATCAGCTTGAAGGTAATGAGGAGGAACATGGAAA
GTATCGCAGTATGGTGGTCCAGTATATAATGAACACTCGTGAAATGTTTGAACCCTTTATTGAGGATGACGTCCCATTTGATGAATACTGCCAATTGATG
GAAAAGGATGGCACATGGGCTGGACATATGGAATTACAAGCAGCTTCTCTTGTTACGCATAGTAATATATGTGTTCACCGGTACATGTCACCACGTTGGT
ACATCCGAAATTTTGATCAGCATGGAGCTCGTATGGTCCATTTATCTTATCATGATGAGGAACATTACAATAGTGTGCGGTCAAAGGATGACCCTTGTAA
TGGGCCAGCTCAGCCAATTATAATCAAGGTTGATGCTGATCTTTCAGCAACATCTGTTCAAGCAAAAGCTGTGTCTAGCACTAAAGCAGGAATTGCAAAG
GACAGTTTTGATGCAGGATCCCTTAAATTGGTCATGGCAGGAAGTGGTTGTGAAAATGCTGAGAAAGTCAAACAGGTTTTACTAGAAGTTGATGGTGATG
TTGATGCTGCAATAGAGTTTTTAATAGCAGAGCAAGAATCAGATTCCTTTTCAGCAGAAAATAATTCCCTTTGTTCTGACACGAATATTTCTTATGAATG
TCAAGGAGATGGTGTAGACGGCAACTGTGAGCAATACAAGGACGAGCCTGTAACAAAGACCAACGAACAAGTTTCATCCAATAATCGCACCAAACAAACC
CACGATGATAGCAGTTCCAGAGAAAATGGCAAGAAGATTCCAAGAAACAAGGACTGTTCCTGTGGATCCAAAAAGAAACACAAGGCATATTGTGGAGCTG
TGAAGGGAAGATCGTCTACTAAGATTGCTGACCGAAAAGTTGACTTTAGAAAAGGTAGAAAAGAAACAAAGCACAACAAGAAAGGACATGCTGAATCCGT
GCCATCCAGTGGATCTGATGGTTGGCTGCCTGACATGGGTGCTCTTTGTATATGA
AA sequence
>Potri.005G140500.22 pacid=42803150 polypeptide=Potri.005G140500.22.p locus=Potri.005G140500 ID=Potri.005G140500.22.v4.1 annot-version=v4.1
MVKTKQQKSKPKKTPHVKKQGKQANIVQFRAQLDALGLKIIEVTADGNCFFRGLADQLEGNEEEHGKYRSMVVQYIMNTREMFEPFIEDDVPFDEYCQLM
EKDGTWAGHMELQAASLVTHSNICVHRYMSPRWYIRNFDQHGARMVHLSYHDEEHYNSVRSKDDPCNGPAQPIIIKVDADLSATSVQAKAVSSTKAGIAK
DSFDAGSLKLVMAGSGCENAEKVKQVLLEVDGDVDAAIEFLIAEQESDSFSAENNSLCSDTNISYECQGDGVDGNCEQYKDEPVTKTNEQVSSNNRTKQT
HDDSSSRENGKKIPRNKDCSCGSKKKHKAYCGAVKGRSSTKIADRKVDFRKGRKETKHNKKGHAESVPSSGSDGWLPDMGALCI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G67170 SEC-C motif-containing protein... Potri.005G140500 0 1
AT3G14830 unknown protein Potri.003G026500 1.73 0.7684
AT2G26280 CID7 CTC-interacting domain 7 (.1) Potri.006G218900 5.00 0.7478
AT2G44430 DNA-binding bromodomain-contai... Potri.009G023100 5.29 0.7519 BRD908
AT1G21200 Trihelix sequence-specific DNA binding ... Potri.003G204700 7.34 0.7278
AT4G27220 NB-ARC domain-containing disea... Potri.018G137900 8.24 0.6663
AT3G03440 ARM repeat superfamily protein... Potri.004G088800 13.41 0.6652
AT3G10400 U11/U12-31K U11/U12-31K, RNA recognition m... Potri.010G227500 18.49 0.7620
AT4G19670 RING/U-box superfamily protein... Potri.015G117600 22.00 0.6825
AT1G09840 AtHIR1, ATSK41 hypersensitive induced reactio... Potri.004G225700 22.27 0.6691 ASK4.1
AT5G62000 ARF ORE14, HSS, ARF... ORESARA 14, HLS1 SUPPRESSOR, A... Potri.015G105300 24.26 0.6892 Pt-ARF2.1

Potri.005G140500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.