Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-AHUS5.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57870 303 / 1e-107 SCE1A, SCE1, AHUS5, EMB1637, ATSCE1 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) AT2G02760 124 / 6e-37 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 122 / 4e-36 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT5G62540 115 / 3e-33 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT1G64230 106 / 6e-30 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G41700 105 / 1e-29 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT4G27960 103 / 7e-29 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT5G53300 103 / 1e-28 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT3G08690 102 / 4e-28 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT3G08700 100 / 1e-27 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G123600 [exp] 290 / 3e-102 AT3G57870 283 / 1e-99 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.014G024950 [exp] 288 / 1e-101 AT3G57870 291 / 6e-103 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.014G024801 [exp] 286 / 9e-101 AT3G57870 251 / 5e-87 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.015G064000 [exp] 125 / 3e-37 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.013G064400 [exp] 125 / 3e-37 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.019G039200 [exp] 124 / 7e-37 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.016G138900 [exp] 105 / 1e-29 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.019G131400 [exp] 104 / 3e-29 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.003G136200 [exp] 104 / 3e-29 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019327 [exp] 324 / 1e-115 AT3G57870 308 / 2e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10009376 [exp] 324 / 1e-115 AT3G57870 306 / 7e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10019328 [exp] 322 / 1e-114 AT3G57870 308 / 3e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10009377 [exp] 320 / 3e-114 AT3G57870 306 / 1e-108 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10036727 [exp] 123 / 2e-36 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10037203 [exp] 123 / 2e-36 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 120 / 3e-35 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10013263 [exp] 120 / 4e-35 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10009422 [exp] 107 / 2e-30 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10028700 [exp] 107 / 2e-30 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.005G141100.1 pacid=42805558 polypeptide=Potri.005G141100.1.p locus=Potri.005G141100 ID=Potri.005G141100.1.v4.1 annot-version=v4.1 ATGTCAGGTGGCATCGCACGTGGTCGTCTTGCCGAGGAAAGGAAGTCCTGGCGCAAAAACCACCCTCATGGTTTTGTGGCGAAACCAGAGACACAGCCAG ATGGAACAGTAAATTTGATGGTCTGGCATTGCACAATCCCTGGAAAACTTGGTACTGATTGGGAAGGTGGTTATTTTCCTCTTACACTCAACTTCAGTGA AGATTATCCTAGCAAGCCACCAAAGTGTAAATTTCCTCAGGGTTTCTTCCACCCTAATGTATATCCATCTGGAACTGTTTGCCTGTCAATCCTTAACGAG GACAGTGGATGGAGACCAGCCATCACAGTGAAGCAGATTCTTGTGGGTATCCAGGACTTGCTGGACCAGCCAAATCCTGCTGATCCTGCCCAAACTGAAG GTTATCATCTGTTTATCCAGGATGCTGCTGAGTACAAGAAAAGAGTGCGCCAGCAAGCTAAGCAATACCCTTCTCTTGTCTAA
AA sequence Show only first row Show all	>Potri.005G141100.1 pacid=42805558 polypeptide=Potri.005G141100.1.p locus=Potri.005G141100 ID=Potri.005G141100.1.v4.1 annot-version=v4.1 MSGGIARGRLAEERKSWRKNHPHGFVAKPETQPDGTVNLMVWHCTIPGKLGTDWEGGYFPLTLNFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNE DSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDAAEYKKRVRQQAKQYPSLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Potri.005G141100 [exp]	0	1	Pt-AHUS5.1
AT5G41340		ATUBC4, UBC4	ubiquitin conjugating enzyme 4...		Potri.003G129700 [exp]	4.47	0.8075	Pt-UBC4.3
AT5G54470	CO		B-box type zinc finger family ...		Potri.011G125400 [exp]	8.12	0.8382
AT1G78895			Reticulon family protein (.1)		Potri.008G004200 [exp]	11.09	0.8566
AT3G23325			Splicing factor 3B subunit 5/R...		Potri.008G168000 [exp]	11.18	0.8035
AT5G49710			unknown protein		Potri.005G157500 [exp]	12.24	0.8310
AT4G39100		SHL1	short life, PHD finger family ...		Potri.004G159900 [exp]	13.26	0.7827
AT2G23620		ATMES1	ARABIDOPSIS THALIANA METHYL ES...		Potri.005G133700 [exp]	14.86	0.8164
AT2G38450			unknown protein		Potri.008G075000 [exp]	15.16	0.8395
AT4G08230			glycine-rich protein (.1.2)		Potri.005G174700 [exp]	15.42	0.8248
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Potri.002G228800 [exp]	15.42	0.8377

Compare expression of checked genes

Potri.005G141100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.