Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35510 82 / 3e-19 SRO1 similar to RCD one 1 (.1) AT1G70440 79 / 1e-18 SRO3 similar to RCD one 3 (.1) AT1G23550 76 / 1e-17 SRO2 similar to RCD one 2 (.1) AT1G32230 74 / 1e-16 ATP8, CEO1, RCD1, AtRCD1 RADICAL-INDUCED CELL DEATH1, ARABIDOPSIS THALIANA P8 \(INTERACTING PROTEIN\), WWE protein-protein interaction domain protein family (.1.2.3) AT5G62520 59 / 2e-11 SRO5 similar to RCD one 5 (.1.2) AT3G47720 51 / 1e-08 SRO4 similar to RCD one 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G112300 [exp] 147 / 1e-43 AT2G35510 185 / 4e-52 similar to RCD one 1 (.1) Potri.003G096700 [exp] 84 / 3e-20 AT1G32230 451 / 4e-152 RADICAL-INDUCED CELL DEATH1, ARABIDOPSIS THALIANA P8 \(INTERACTING PROTEIN\), WWE protein-protein interaction domain protein family (.1.2.3) Potri.001G137200 [exp] 83 / 8e-20 AT1G32230 479 / 6e-163 RADICAL-INDUCED CELL DEATH1, ARABIDOPSIS THALIANA P8 \(INTERACTING PROTEIN\), WWE protein-protein interaction domain protein family (.1.2.3) Potri.006G231500 [exp] 75 / 4e-17 AT1G23550 219 / 2e-69 similar to RCD one 2 (.1) Potri.006G231100 [exp] 74 / 8e-17 AT1G23550 207 / 2e-64 similar to RCD one 2 (.1) Potri.015G076500 [exp] 74 / 9e-17 AT5G62520 251 / 2e-81 similar to RCD one 5 (.1.2) Potri.006G231600 [exp] 73 / 1e-16 AT1G23550 185 / 6e-56 similar to RCD one 2 (.1) Potri.012G081100 [exp] 72 / 6e-16 AT5G62520 243 / 2e-78 similar to RCD one 5 (.1.2) Potri.018G055100 [exp] 64 / 4e-13 AT1G23550 208 / 5e-65 similar to RCD one 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030611 [exp] 84 / 3e-20 AT1G23550 219 / 7e-69 similar to RCD one 2 (.1) Lus10030878 [exp] 82 / 2e-19 AT1G23550 223 / 1e-70 similar to RCD one 2 (.1) Lus10029152 [exp] 79 / 1e-18 AT1G23550 219 / 4e-69 similar to RCD one 2 (.1) Lus10013012 [exp] 79 / 2e-18 AT1G23550 218 / 1e-68 similar to RCD one 2 (.1) Lus10035390 [exp] 76 / 4e-17 AT2G35510 352 / 5e-114 similar to RCD one 1 (.1) Lus10030991 [exp] 72 / 5e-16 AT1G32230 376 / 2e-123 RADICAL-INDUCED CELL DEATH1, ARABIDOPSIS THALIANA P8 \(INTERACTING PROTEIN\), WWE protein-protein interaction domain protein family (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G149701.1 pacid=42803032 polypeptide=Potri.005G149701.1.p locus=Potri.005G149701 ID=Potri.005G149701.1.v4.1 annot-version=v4.1 ATGATTTGGGTCTGTGTTCTCAGTGCCAAGTTCTCAGAGGCAGATGATAATGGCGAAAAACATATTATACCGTGTAGAGCTATATTAGGTAATGTTGAGA AAGTAGTAACAGGGTCTCAACAGTATTATCCTTCTGGTATTGAGTTCTATACCGGTGCTGATGATCCCAAGAATCATCCCAAGTGTTATGTTGTTTGGTC GAGTGTTATGAACAGGCATATTATCCCTGAGTGTGTTGTGAGCTTCAAATCTTCTATTAACGTGCCAGGTAAATTCTGGTTCCTCGTTTTCGTAAGTATT TTTATTGATTGCTATTTTTCTTTTTAA
AA sequence Show only first row Show all	>Potri.005G149701.1 pacid=42803032 polypeptide=Potri.005G149701.1.p locus=Potri.005G149701 ID=Potri.005G149701.1.v4.1 annot-version=v4.1 MIWVCVLSAKFSEADDNGEKHIIPCRAILGNVEKVVTGSQQYYPSGIEFYTGADDPKNHPKCYVVWSSVMNRHIIPECVVSFKSSINVPGKFWFLVFVSI FIDCYFSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G35510		SRO1	similar to RCD one 1 (.1)		Potri.005G149701 [exp]	0	1
AT4G32551		RON2, LUG	ROTUNDA 2, LEUNIG, LisH dimeri...		Potri.018G033300 [exp]	2.00	0.8250
AT1G13810			Restriction endonuclease, type...		Potri.008G039800 [exp]	4.47	0.8259
AT5G25560			CHY-type/CTCHY-type/RING-type ...		Potri.006G245400 [exp]	8.24	0.7610
AT5G56310			Pentatricopeptide repeat (PPR)...		Potri.003G223900 [exp]	12.16	0.8045
AT3G08820			Pentatricopeptide repeat (PPR)...		Potri.016G128900 [exp]	12.44	0.7946
AT1G29750		RKF1	receptor-like kinase in flower...		Potri.011G072566 [exp]	12.64	0.7849
AT5G55390		EDM2	ENHANCED DOWNY MILDEW 2 (.1.2)		Potri.001G359900 [exp]	13.30	0.8214
AT5G64320			Pentatricopeptide repeat (PPR)...		Potri.013G002800 [exp]	14.38	0.7840
AT4G33170			Tetratricopeptide repeat (TPR)...		Potri.006G076100 [exp]	20.78	0.7608
AT5G67570		EMB246, DG1, EM...	EMBRYO DEFECTIVE 246, embryo d...		Potri.007G004900 [exp]	23.21	0.7762

Compare expression of checked genes

Potri.005G149701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.