Plant FIBer expression Database

Potri.005G150450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01130 105 / 5e-27 ATCG01130.1, YCF1.2 Ycf1 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.005G150450.1 pacid=42805179 polypeptide=Potri.005G150450.1.p locus=Potri.005G150450 ID=Potri.005G150450.1.v4.1 annot-version=v4.1
ATGATTAATAAATACATTTATATGTATAATAAAAAAGAAAATCACAAAAGAATTGAGAAAACAAATCAAAATACACTAATTCACTTTATCTCGATTATAA
AAAAGGCATTAAATTATAGTAATTTTAATAAGAACTCGAAGATTTTTTATAACATAACCTCCTTGTCACAAGCATATGTATTTTACAAATTATCACAAGT
CCAAGTTATTAACCTATATAAGTTAAGATCTGTCTTTCAATATCATGGAGCATCTCTTTTTCTTAAGAATGAAATAAAAGATTATTTTGGAGTCCAAGGA
AGATTTCAGTTCAAATTAAAAGATACAAATTTTAGAAATTCTGTAATGAATGAATGGAAAAACTGGGTAAGAAGTACTTATCAATATAAATACGATTTAT
CTCAGATCAGATGGTCTAGCTTAATATCGCAAAAATAG
AA sequence
>Potri.005G150450.1 pacid=42805179 polypeptide=Potri.005G150450.1.p locus=Potri.005G150450 ID=Potri.005G150450.1.v4.1 annot-version=v4.1
MINKYIYMYNKKENHKRIEKTNQNTLIHFISIIKKALNYSNFNKNSKIFYNITSLSQAYVFYKLSQVQVINLYKLRSVFQYHGASLFLKNEIKDYFGVQG
RFQFKLKDTNFRNSVMNEWKNWVRSTYQYKYDLSQIRWSSLISQK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.005G150450
[exp]
0 1
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.013G075166
[exp]
3.74 0.9710
AT5G17590 Putative membrane lipoprotein ... Potri.019G043701
[exp]
6.24 0.9464
ATCG01000 ATCG01000.1, YC... Ycf1 protein (.1) Potri.011G073900
[exp]
12.64 0.9241
ATCG01300 ATCG01300.1, RP... ribosomal protein L23 (.1) Potri.013G138612
[exp]
13.71 0.9565
Potri.005G150475
[exp]
13.74 0.9531
AT4G36520 Chaperone DnaJ-domain superfam... Potri.005G120700
[exp]
13.78 0.9251
ATCG01300 ATCG01300.1, RP... ribosomal protein L23 (.1) Potri.005G154350
[exp]
16.43 0.9543
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.010G052900
[exp]
20.12 0.9504
AT2G25720 unknown protein Potri.004G068400
[exp]
24.10 0.8666
AT3G50740 UGT72E1 UDP-glucosyl transferase 72E1 ... Potri.007G029800
[exp]
26.26 0.8237

Potri.005G150450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.