Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G21990 79 / 2e-18 OEP61, TPR7 tetratricopeptide repeat 7, outer envelope protein 61, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G190600 [exp] 122 / 1e-33 AT5G21990 693 / 0.0 tetratricopeptide repeat 7, outer envelope protein 61, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.009G151700 [exp] 108 / 5e-29 AT5G21990 700 / 0.0 tetratricopeptide repeat 7, outer envelope protein 61, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019379 [exp] 68 / 2e-14 AT5G21990 658 / 0.0 tetratricopeptide repeat 7, outer envelope protein 61, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10036162 [exp] 61 / 6e-12 AT5G64220 818 / 0.0 Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G156250.1 pacid=42803176 polypeptide=Potri.005G156250.1.p locus=Potri.005G156250 ID=Potri.005G156250.1.v4.1 annot-version=v4.1 ATGATATGGCCTGTTGAGCTTTTGCTACATCTTCTTGAGAGTTTTATTCCAAGTTGCTCACTCATGTTAGCCATCATCTCTGTGCTCATATTCTTCATCA TTGACGTGAACATCTGCTGCATAGCTGGATCTTTCATTTGGTCTCTCATTTGTTCTTGCATATCAAAAGATGAGGCAGGAAAGCTTGATGAACTAGTTCC ACTGATGCCATTATTCCTATTAACTGCAAAATTTCCTCGAGTTTCTGTTGGTTTTGCCCCAGCACCCGGACCTGATCCATCAGTGTTTAAAGTTGAAGAT AGCCGGAACTGA
AA sequence Show only first row Show all	>Potri.005G156250.1 pacid=42803176 polypeptide=Potri.005G156250.1.p locus=Potri.005G156250 ID=Potri.005G156250.1.v4.1 annot-version=v4.1 MIWPVELLLHLLESFIPSCSLMLAIISVLIFFIIDVNICCIAGSFIWSLICSCISKDEAGKLDELVPLMPLFLLTAKFPRVSVGFAPAPGPDPSVFKVED SRN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G21990		OEP61, TPR7	tetratricopeptide repeat 7, ou...		Potri.005G156250 [exp]	0	1
AT5G19820		EMB2734	embryo defective 2734, ARM rep...		Potri.017G137400 [exp]	5.74	0.8442
AT4G16380			Heavy metal transport/detoxifi...		Potri.006G020500 [exp]	6.92	0.8803
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Potri.009G045601 [exp]	6.92	0.8981
AT1G10010		AAP8, ATAAP8	amino acid permease 8 (.1)		Potri.013G103551 [exp]	12.96	0.8388
AT5G39040		AtALS1, ABCB27,...	ARABIDOPSIS THALIANA TRANSPORT...		Potri.016G106650 [exp]	13.03	0.7891
AT3G48940			Remorin family protein (.1)		Potri.012G140900 [exp]	15.49	0.8711
AT1G29350			Kinase-related protein of unkn...		Potri.002G059300 [exp]	18.70	0.8689
					Potri.004G179822 [exp]	25.09	0.7718
					Potri.018G011950 [exp]	29.89	0.8581
AT1G49350			pfkB-like carbohydrate kinase ...		Potri.004G151600 [exp]	31.08	0.8133

Compare expression of checked genes

Potri.005G156250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.