Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09740 126 / 2e-38 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 51 / 8e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 49 / 7e-08 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G62550 42 / 8e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G104700 [exp] 154 / 2e-49 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 54 / 4e-10 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 50 / 7e-09 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 44 / 2e-06 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 44 / 3e-06 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.008G221300 [exp] 43 / 6e-06 AT2G47710 199 / 2e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 39 / 0.0001 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.014G130100 [exp] 39 / 0.0002 AT2G47710 234 / 4e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.017G071700 [exp] 38 / 0.0004 AT5G14680 298 / 6e-105 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009272 [exp] 142 / 3e-44 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10015896 [exp] 139 / 2e-43 AT1G09740 185 / 3e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 50 / 8e-09 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 52 / 1e-08 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10029850 [exp] 50 / 4e-08 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 46 / 5e-07 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 38 / 0.0004 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10014545 [exp] 37 / 0.0007 AT5G14680 295 / 6e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10032142 [exp] 37 / 0.0007 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G157100.2 pacid=42804203 polypeptide=Potri.005G157100.2.p locus=Potri.005G157100 ID=Potri.005G157100.2.v4.1 annot-version=v4.1 ATGAAAATGAAAATAAAAATAAAATCACCTTCTATCATCCTCCTTTTCCAATCACCACCTTCTATCGCTGCTGGACTTAATCTCGGTGCCATCCCGTTCG GTGGATTCAGTGATCTGGAGGTACCTGCCTTCAAGGCGGCGATTGAAGCGCATCAAAGGAAGATTACGGAGGCGATTCTAGAACATGCCTTGGAGATTTG CCATGAAAAGAAAGAAAATGTGAAAATACAAGGGGTGATGGGGGATTCGAAGGAGAAGATGTGTGAAGTTGTTGAGAATCTACATTCTGATTTGCTTGTG ATGGGCTGTCGTTCTTTTGGCCCCTATTAA
AA sequence Show only first row Show all	>Potri.005G157100.2 pacid=42804203 polypeptide=Potri.005G157100.2.p locus=Potri.005G157100 ID=Potri.005G157100.2.v4.1 annot-version=v4.1 MKMKIKIKSPSIILLFQSPPSIAAGLNLGAIPFGGFSDLEVPAFKAAIEAHQRKITEAILEHALEICHEKKENVKIQGVMGDSKEKMCEVVENLHSDLLV MGCRSFGPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G09740			Adenine nucleotide alpha hydro...		Potri.005G157100 [exp]	0	1
AT2G16950		ATTRN1	transportin 1 (.1.2)		Potri.009G138200 [exp]	1.41	0.9333
AT2G33150		PED1, KAT2, PKT...	PEROXISOME DEFECTIVE 1, 3-KETO...		Potri.001G051800 [exp]	4.47	0.8668
AT1G11800			endonuclease/exonuclease/phosp...		Potri.004G010900 [exp]	5.09	0.8798
					Potri.006G095100 [exp]	7.41	0.8959
AT1G07860			unknown protein		Potri.009G093700 [exp]	7.48	0.8780
AT5G43670			Sec23/Sec24 protein transport ...		Potri.008G161300 [exp]	8.48	0.8928
AT3G26000			Ribonuclease inhibitor (.1)		Potri.008G179800 [exp]	8.48	0.8826
					Potri.003G027933 [exp]	9.38	0.8655
AT2G40770			zinc ion binding;DNA binding;h...		Potri.019G060000 [exp]	12.00	0.8802
AT5G51980	C3HZnF		Transducin/WD40 repeat-like su...		Potri.014G077800 [exp]	16.49	0.8460

Compare expression of checked genes

Potri.005G157100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.