Plant FIBer expression Database

Potri.005G158000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G50011 88 / 2e-25 CPuORF37 conserved peptide upstream open reading frame 37 (.1)
AT5G09461 79 / 1e-21 CPuORF43 conserved peptide upstream open reading frame 43 (.1)
AT5G64341 78 / 2e-21 CPuORF40 conserved peptide upstream open reading frame 40 (.1)
AT1G29951 39 / 3e-06 CPuORF35 conserved peptide upstream open reading frame 35 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G103400
[exp]
112 / 5e-35 AT5G50011 88 / 2e-25 conserved peptide upstream open reading frame 37 (.1)
Potri.007G112900
[exp]
101 / 1e-30 AT5G50011 87 / 5e-25 conserved peptide upstream open reading frame 37 (.1)
Potri.017G047932
[exp]
100 / 3e-30 AT5G50011 86 / 2e-24 conserved peptide upstream open reading frame 37 (.1)
Potri.011G080100
[exp]
43 / 1e-07 AT1G29951 53 / 1e-11 conserved peptide upstream open reading frame 35 (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.005G158000.1 pacid=42804925 polypeptide=Potri.005G158000.1.p locus=Potri.005G158000 ID=Potri.005G158000.1.v4.1 annot-version=v4.1
ATGGTGTGCCAAGCTGCGAGCCAAACAAATTTTCGGGCATTGAAACACGAAAACGGGATTGCTGGGTGTGCCACCATTATAGTTAGAGTTATAGCATGCT
TTCAACCGCTTCAGGATTGCCAGGCTGAATATTTCCGTCATCTGCTTAAACCTGTCACGTAG
AA sequence
>Potri.005G158000.1 pacid=42804925 polypeptide=Potri.005G158000.1.p locus=Potri.005G158000 ID=Potri.005G158000.1.v4.1 annot-version=v4.1
MVCQAASQTNFRALKHENGIAGCATIIVRVIACFQPLQDCQAEYFRHLLKPVT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G50011 CPuORF37 conserved peptide upstream ope... Potri.005G158000
[exp]
0 1
AT1G58122 CPuORF45 conserved peptide upstream ope... Potri.007G113150
[exp]
3.87 0.8571
AT5G14280 GeBP DNA-binding storekeeper protei... Potri.010G056000
[exp]
5.83 0.8411
AT1G29951 CPuORF35 conserved peptide upstream ope... Potri.011G080100
[exp]
5.83 0.7420
AT2G27228 CPuORF6 conserved peptide upstream ope... Potri.001G216800
[exp]
7.14 0.8367
Potri.010G080633
[exp]
7.74 0.8338
AT2G02540 ZF_HD ATHB21, ZFHD4, ... ZINC FINGER HOMEODOMAIN 3, ZIN... Potri.013G048466
[exp]
11.13 0.7020
AT2G31280 bHLH bHLH155 ,CPuORF... conserved peptide upstream ope... Potri.005G222550
[exp]
11.31 0.8004
AT5G50011 CPuORF37 conserved peptide upstream ope... Potri.002G103400
[exp]
11.74 0.7161
AT1G56070 LOS1, AT1G56075... LOW EXPRESSION OF OSMOTICALLY ... Potri.002G177032
[exp]
12.12 0.8027
Potri.005G187000
[exp]
12.36 0.7995

Potri.005G158000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.